Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9742.t1
Gene name
Locationscaffold_71:7925..9647
Strand-
Gene length (bp)1722
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.5E-13 75 260
PF08386 Abhydrolase_4 TAP-like protein 4.9E-13 446 521

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.78 0.00 1.56
5d_25C Five days - 25 degrees Celsius 1.91 0.39 3.42
7d_25C Seven days - 25 degrees Celsius 2.05 0.46 3.64
10d_25C Ten days - 25 degrees Celsius 2.91 0.78 5.04
7d_15C Seven days - 15 degrees Celsius 2.03 0.31 3.75
7d_30C Seven days - 30 degrees Celsius 2.62 0.66 4.58

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.089205 no
3d_25C 7d_25C 0.063693 no
3d_25C 7d_15C 0.074116 no
3d_25C 7d_30C 0.021163 yes
3d_25C 10d_25C 0.013211 yes
5d_25C 7d_25C 0.913723 no
5d_25C 7d_15C 0.930109 no
5d_25C 7d_30C 0.525373 no
5d_25C 10d_25C 0.371995 no
7d_25C 7d_15C 0.987275 no
7d_25C 7d_30C 0.646898 no
7d_25C 10d_25C 0.484970 no
7d_15C 7d_30C 0.647383 no
7d_15C 10d_25C 0.492853 no
7d_30C 10d_25C 0.863124 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9742.t1
MSSLSSVKYFLLAGCLSASTALASLQWSPCPANPALDCSTLRVPLEYAEPQSGMSASIPLARYNATVEVSQRKGS
LLTNPGGPGASGVSFVVNGAGEGISNITGGFYDIIGWDPRGVGSAQPVLQCFATAGEEYEASQVLPAAPDVAYGQ
FRNQSYTPFYNAAMQEFDSMTAQLAAACASYNSTASYTSSAAYVVRDMGAIVDALDGKDARLNYWGLSYGTIFGV
EFIQTYPERVGRIVLDGVFDATANAETYVAQLPNDQLSVRDAINDLVSFCEQAGPAGCALSTPPANVTADLTTRL
ANLQDSLYEHPIPVSQGFSITVGIFSAFMWSFSRVPTTWPLISSVVSALEQGDATPIVSILNAAAASPPANSKAP
ATGSLAEWPLQCVDNAPSSGISLADVASLVLNVSLREDTPWLNADVTPLSFCRHFPDTRARIPNLGASKVRDANS
ILTEQNTPVLIVNGEHDPVTPLASAERLQSQLATASRLVTRRGPGHTTVSIASLGLTEAIRAYFIGNTLPTSAVH
DLSQVVFSSAINAGTLTPAPVFNGTYSEAELTLLNSTYNILLAFLSLA*
Coding >Pro_DTO377G3_2|g9742.t1
ATGTCCTCTCTCTCTTCTGTTAAGTACTTCCTTCTTGCTGGATGCCTGTCGGCATCTACGGCTCTTGCCAGCCTT
CAATGGTCACCCTGTCCTGCAAATCCAGCGTTGGATTGCTCAACCCTCCGAGTGCCGCTTGAGTATGCGGAGCCA
CAGAGCGGGATGTCAGCTTCTATTCCGCTTGCCCGATACAACGCCACGGTAGAGGTATCCCAGCGCAAAGGCTCA
CTTCTCACGAATCCTGGGGGTCCTGGTGCGTCTGGTGTCTCCTTCGTCGTGAACGGCGCCGGGGAAGGAATATCG
AACATCACCGGGGGGTTTTACGATATAATTGGATGGGACCCGCGCGGTGTGGGTTCCGCTCAACCCGTCTTGCAA
TGTTTTGCTACCGCCGGAGAAGAGTATGAAGCGTCCCAGGTGCTTCCAGCTGCGCCTGACGTGGCGTACGGCCAG
TTCAGAAACCAATCCTACACGCCCTTTTACAACGCTGCGATGCAGGAGTTTGACAGCATGACCGCCCAGCTTGCT
GCCGCATGTGCATCTTACAATTCGACAGCTTCGTATACTTCTAGCGCGGCCTACGTTGTTCGTGACATGGGGGCT
ATTGTCGATGCATTGGACGGCAAAGATGCCCGTTTGAATTACTGGGGTCTCTCCTACGGGACCATTTTTGGGGTA
GAATTTATTCAGACCTATCCGGAGAGGGTCGGGAGGATTGTCCTGGACGGCGTTTTTGATGCTACTGCCAATGCT
GAGACCTATGTCGCCCAGCTTCCCAATGACCAACTCTCCGTGCGAGATGCTATCAACGATCTGGTGTCATTTTGC
GAACAAGCTGGTCCAGCTGGCTGTGCTCTGAGTACTCCTCCTGCAAATGTAACTGCCGACCTGACCACTCGACTT
GCTAATTTACAAGATTCCCTCTACGAACATCCCATTCCGGTCTCTCAAGGGTTCTCCATCACCGTTGGGATCTTC
AGCGCATTCATGTGGTCCTTTTCCCGAGTTCCGACTACTTGGCCCCTTATCTCCTCAGTTGTGAGCGCTCTTGAG
CAAGGAGATGCGACTCCAATAGTGTCCATTCTTAATGCAGCTGCCGCCAGTCCGCCAGCCAATTCCAAAGCTCCA
GCCACTGGGTCTCTAGCTGAATGGCCCCTGCAGTGTGTGGATAATGCGCCGTCCAGTGGCATCTCCTTGGCGGAC
GTTGCTTCCCTAGTACTCAATGTCTCTCTCCGCGAGGATACCCCTTGGCTGAATGCTGACGTGACTCCCCTATCC
TTCTGTCGCCACTTTCCGGACACCCGCGCAAGAATCCCGAACTTGGGAGCCTCGAAAGTCCGCGATGCAAACTCC
ATCCTCACTGAGCAAAATACCCCGGTGCTGATTGTCAATGGCGAACATGACCCCGTGACTCCGTTGGCCTCTGCA
GAGCGTTTGCAGAGTCAGCTTGCTACCGCGTCCCGGTTGGTGACCAGACGAGGCCCAGGTCATACAACAGTCAGC
ATTGCGTCGTTGGGGCTGACAGAGGCCATCCGTGCATACTTTATTGGCAATACCCTTCCAACAAGCGCCGTTCAC
GACCTCAGCCAGGTGGTATTCTCCTCCGCAATCAACGCCGGGACATTAACCCCCGCTCCAGTATTCAATGGTACA
TACTCCGAGGCAGAGCTGACTCTACTGAACTCCACATACAATATTTTGTTAGCATTCCTCAGCTTAGCATAA
Transcript >Pro_DTO377G3_2|g9742.t1
ATGTCCTCTCTCTCTTCTGTTAAGTACTTCCTTCTTGCTGGATGCCTGTCGGCATCTACGGCTCTTGCCAGCCTT
CAATGGTCACCCTGTCCTGCAAATCCAGCGTTGGATTGCTCAACCCTCCGAGTGCCGCTTGAGTATGCGGAGCCA
CAGAGCGGGATGTCAGCTTCTATTCCGCTTGCCCGATACAACGCCACGGTAGAGGTATCCCAGCGCAAAGGCTCA
CTTCTCACGAATCCTGGGGGTCCTGGTGCGTCTGGTGTCTCCTTCGTCGTGAACGGCGCCGGGGAAGGAATATCG
AACATCACCGGGGGGTTTTACGATATAATTGGATGGGACCCGCGCGGTGTGGGTTCCGCTCAACCCGTCTTGCAA
TGTTTTGCTACCGCCGGAGAAGAGTATGAAGCGTCCCAGGTGCTTCCAGCTGCGCCTGACGTGGCGTACGGCCAG
TTCAGAAACCAATCCTACACGCCCTTTTACAACGCTGCGATGCAGGAGTTTGACAGCATGACCGCCCAGCTTGCT
GCCGCATGTGCATCTTACAATTCGACAGCTTCGTATACTTCTAGCGCGGCCTACGTTGTTCGTGACATGGGGGCT
ATTGTCGATGCATTGGACGGCAAAGATGCCCGTTTGAATTACTGGGGTCTCTCCTACGGGACCATTTTTGGGGTA
GAATTTATTCAGACCTATCCGGAGAGGGTCGGGAGGATTGTCCTGGACGGCGTTTTTGATGCTACTGCCAATGCT
GAGACCTATGTCGCCCAGCTTCCCAATGACCAACTCTCCGTGCGAGATGCTATCAACGATCTGGTGTCATTTTGC
GAACAAGCTGGTCCAGCTGGCTGTGCTCTGAGTACTCCTCCTGCAAATGTAACTGCCGACCTGACCACTCGACTT
GCTAATTTACAAGATTCCCTCTACGAACATCCCATTCCGGTCTCTCAAGGGTTCTCCATCACCGTTGGGATCTTC
AGCGCATTCATGTGGTCCTTTTCCCGAGTTCCGACTACTTGGCCCCTTATCTCCTCAGTTGTGAGCGCTCTTGAG
CAAGGAGATGCGACTCCAATAGTGTCCATTCTTAATGCAGCTGCCGCCAGTCCGCCAGCCAATTCCAAAGCTCCA
GCCACTGGGTCTCTAGCTGAATGGCCCCTGCAGTGTGTGGATAATGCGCCGTCCAGTGGCATCTCCTTGGCGGAC
GTTGCTTCCCTAGTACTCAATGTCTCTCTCCGCGAGGATACCCCTTGGCTGAATGCTGACGTGACTCCCCTATCC
TTCTGTCGCCACTTTCCGGACACCCGCGCAAGAATCCCGAACTTGGGAGCCTCGAAAGTCCGCGATGCAAACTCC
ATCCTCACTGAGCAAAATACCCCGGTGCTGATTGTCAATGGCGAACATGACCCCGTGACTCCGTTGGCCTCTGCA
GAGCGTTTGCAGAGTCAGCTTGCTACCGCGTCCCGGTTGGTGACCAGACGAGGCCCAGGTCATACAACAGTCAGC
ATTGCGTCGTTGGGGCTGACAGAGGCCATCCGTGCATACTTTATTGGCAATACCCTTCCAACAAGCGCCGTTCAC
GACCTCAGCCAGGTGGTATTCTCCTCCGCAATCAACGCCGGGACATTAACCCCCGCTCCAGTATTCAATGGTACA
TACTCCGAGGCAGAGCTGACTCTACTGAACTCCACATACAATATTTTGTTAGCATTCCTCAGCTTAGCATAA
Gene >Pro_DTO377G3_2|g9742.t1
ATGTCCTCTCTCTCTTCTGTTAAGTACTTCCTTCTTGCTGGATGCCTGTCGGCATCTACGGCTCTTGCCAGCCTT
CAATGGTCACCCTGTCCTGCAAATCCAGCGTTGGATTGCTCAACCCTCCGAGTGCCGCTTGAGTATGCGGAGCCA
CAGAGCGGGATGTCAGCTTCTATTCCGCTTGCCCGATACAACGCCACGGTAGAGGTATCCCAGCGCAAAGGCTCA
CTTCTCACGAATCCTGGGGGTCCTGGTGCGTCTGGTGTCTCCTTCGTCGTGAACGGCGCCGGGGAAGGAATATCG
AACATCACCGGGGGGTTTTACGATATAATTGGATGGGACCCGCGCGGTGTGGGTTCCGCTCAACCCGTCTTGCAA
TGTTTTGCTACCGCCGGAGAAGAGTATGAAGCGTCCCAGGTGCTTCCAGCTGCGCCTGACGTGGCGTACGGCCAG
TTCAGAAACCAATCCTACACGCCCTTTTACAACGCTGCGATGCAGGAGTTTGACAGCATGACCGCCCAGCTTGCT
GCCGCATGTGCATCTTACAATTCGACAGCTTCGTATACTTCTAGCGCGGCCTACGTTGTTCGTGACATGGGGGCT
ATTGTCGATGCATTGGACGGCAAAGATGCCCGTTTGAATTACTGGGGTCTCTCCTACGGGACCATTTTTGGGGTA
GAATTTATTCAGACCTATCCGGAGAGGGTCGGGAGGATTGTCCTGGACGGCGTTTTTGATGCTACTGCCAATGCT
GAGACCTATGTCGCCCAGCTTCCCAATGACCAACTCTCCGTGCGAGATGCTATCAACGATCTGGTGTCATTTTGC
GAACAAGCTGGTCCAGCTGGCTGTGCTCTGAGTACTCCTCCTGCAAATGTAACTGCCGACCTGACCACTCGACTT
GCTAATTTACAAGATTCCCTCTACGAACATCCCATTCCGGTCTCTCAAGGGTTCTCCATCACCGTTGGGATCTTC
AGCGCATTCATGTGGTCCTTTTCCCGAGTTCCGACTACTTGGCCCCTTATCTCCTCAGTTGTGAGCGCTCTTGAG
CAAGGAGATGCGACTCCAATAGTGTCCATTCTTAATGCAGCTGCCGCCAGTCCGCCAGCCAATTCCAAAGCTCCA
GCCACTGGGTCTCTAGCTGAATGGCCCCTGCAGTGTGTGGATAATGCGCCGTCCAGTGGCATCTCCTTGGCGGAC
GTTGCTTCCCTAGTACTCAATGTCTCTCTCCGCGAGGATACCCCTTGGCTGAATGCTGACGTGACTCCCCTATCC
TTCTGTCGCCACTTTCCGGACACCCGCGCAAGAATCCCGAACTTGGGAGCCTCGAAAGTCCGCGATGCAAACTCC
ATCCTCACTGAGCAAAATACCCCGGTGCTGATTGTCAATGGCGAACATGACCCCGTGACTCCGTTGGCCTCTGCA
GAGCGTTTGCAGAGTCAGCTTGCTACCGCGTCCCGGTTGGTGACCAGACGAGGCCCAGGTCATACAACAGTCAGC
ATTGCGTCGTTGGGGCTGACAGAGGCCATCCGTGCATACTTTATTGGCAATACCCTTCCAACAAGCGCCGTTCAC
GACCTCAGCCAGGTGGTATTCTCCTCCGCAATCAACGCCGGGACATTAACCCCCGCTCCAGTATTCAATGGTACA
TACTCCGAGGCAGAGCTGACTCTACTGAACTCCACATACAATATTTTGTTAGCATTCCTCAGCTTAGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail