Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g974.t1
Gene name
Locationscaffold_01:2582413..2584027
Strand+
Gene length (bp)1614
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07930 DAP_B D-aminopeptidase, domain B 4.2E-75 353 533
PF00144 Beta-lactamase Beta-lactamase 2.6E-43 17 330

GO

GO Term Description Terminal node
GO:0004177 aminopeptidase activity Yes
GO:0008238 exopeptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 106.55 64.97 148.12
5d_25C Five days - 25 degrees Celsius 44.80 26.59 63.02
7d_25C Seven days - 25 degrees Celsius 47.41 27.32 67.49
10d_25C Ten days - 25 degrees Celsius 14.52 6.88 22.16
7d_15C Seven days - 15 degrees Celsius 55.65 32.09 79.21
7d_30C Seven days - 30 degrees Celsius 18.98 9.82 28.13

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.005235 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.868751 no
5d_25C 7d_15C 0.409984 no
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.581870 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.000700 yes
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.407882 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g974.t1
MAIDEKVQAVLNKTVLRYRGPGGAIAVVKDGEVIGQRVWGFADLDQRIPMTAQTQIPICSITKQFVCALLIDLER
NPTPTLAAKGDVRKQLSDHLAEILSPELTSDGELTIDHLCDMQSGMRDYWAMTTLWGSKPDDEFLIARDCGPLLA
RTKSFMFQPGTEYSYCNVNFHVLARIIERATGESLAKLLEERILRPAGMSTAFLCPNTAHHPPPCVGYEGDEQHG
FTAAVNRMEWSGDAGLVASLADMIEYEKYLDRCYADPQSWYHTAIAAPKFKDGTPAKYRYGLDHADIAGVNTIGH
GGALRGYRLHRRHAPRERLSVVVMSNSDFGAFGPNMEILHELLGIPKPVASTVQPAADWVGAFLDQDTQLSIVIT
KGARDGEVAIRYDGSAEPIKLSAPNHGKSDSMVATIDGDFLSIHRVVDNRILSARRIVPKESILKGTSFQGVYHC
AEIESTFHCIGEDGMLYGAFDGYLGQGIATPMKYLGDDVWVLTCPRGLDAPAPGDWTVVFSRDEHDAIQGFTIGC
WLARKVDYVKRA*
Coding >Pro_DTO377G3_2|g974.t1
ATGGCAATTGACGAAAAGGTTCAAGCGGTCTTGAACAAAACGGTCCTGCGTTATCGCGGCCCAGGAGGTGCCATC
GCCGTCGTCAAAGATGGCGAGGTCATCGGCCAGCGTGTCTGGGGATTCGCCGATCTCGACCAGCGAATTCCCATG
ACAGCTCAAACGCAAATCCCCATCTGTTCAATTACAAAACAATTTGTGTGTGCGTTGTTGATCGACCTGGAGCGC
AATCCAACCCCAACACTAGCTGCAAAGGGCGATGTCCGGAAGCAGCTCTCAGATCACCTCGCCGAGATACTAAGC
CCGGAGCTCACTTCTGACGGTGAACTGACAATTGATCACTTATGCGACATGCAATCCGGCATGCGCGACTACTGG
GCTATGACCACACTATGGGGGTCCAAACCCGACGATGAGTTCCTGATAGCTAGAGACTGCGGCCCACTGCTTGCC
CGAACCAAGTCATTCATGTTCCAGCCGGGAACGGAGTATTCCTACTGCAATGTCAATTTCCACGTCCTTGCCCGA
ATCATCGAGCGAGCTACGGGCGAGTCTCTTGCCAAATTGCTCGAAGAGCGGATACTCCGACCGGCTGGTATGAGC
ACGGCATTCCTTTGCCCCAACACCGCACATCACCCACCGCCCTGTGTCGGGTATGAGGGCGACGAGCAGCACGGC
TTCACGGCCGCTGTCAATAGGATGGAATGGTCCGGTGATGCTGGACTAGTGGCTTCACTCGCTGATATGATCGAG
TACGAGAAGTATCTCGATCGCTGTTACGCTGATCCGCAGAGCTGGTACCACACCGCGATCGCTGCTCCGAAGTTT
AAAGATGGCACTCCTGCAAAATACCGTTATGGGCTAGATCACGCTGACATCGCTGGCGTGAACACCATTGGACAC
GGTGGAGCGTTGCGAGGGTATCGACTGCATCGGCGACACGCTCCACGCGAGCGTTTGTCCGTCGTTGTTATGTCT
AACAGTGACTTCGGTGCATTCGGCCCCAATATGGAGATCCTCCACGAGCTCTTGGGAATACCTAAGCCTGTGGCA
TCAACCGTCCAGCCGGCCGCGGACTGGGTCGGCGCGTTTCTTGATCAAGATACTCAGCTGTCGATTGTCATCACC
AAGGGCGCGCGGGATGGAGAGGTGGCTATCAGATACGACGGGTCGGCCGAGCCTATCAAGCTTAGTGCACCGAAT
CATGGGAAGTCCGATTCCATGGTCGCGACGATTGATGGAGATTTTTTGAGTATTCATCGTGTGGTAGATAACCGG
ATACTCAGTGCTCGGCGTATTGTCCCGAAAGAGTCAATCCTTAAAGGGACTTCATTCCAGGGTGTCTATCACTGT
GCCGAGATTGAATCTACCTTCCATTGCATTGGCGAGGATGGCATGCTATATGGTGCGTTCGATGGATATCTGGGT
CAAGGAATTGCAACTCCCATGAAATATCTGGGAGATGATGTCTGGGTGTTGACTTGCCCACGTGGTTTGGATGCG
CCAGCTCCGGGAGACTGGACCGTTGTCTTTTCTCGGGATGAGCATGATGCAATCCAAGGGTTTACTATTGGTTGT
TGGTTGGCTAGGAAAGTTGACTATGTGAAGAGAGCCTGA
Transcript >Pro_DTO377G3_2|g974.t1
ATGGCAATTGACGAAAAGGTTCAAGCGGTCTTGAACAAAACGGTCCTGCGTTATCGCGGCCCAGGAGGTGCCATC
GCCGTCGTCAAAGATGGCGAGGTCATCGGCCAGCGTGTCTGGGGATTCGCCGATCTCGACCAGCGAATTCCCATG
ACAGCTCAAACGCAAATCCCCATCTGTTCAATTACAAAACAATTTGTGTGTGCGTTGTTGATCGACCTGGAGCGC
AATCCAACCCCAACACTAGCTGCAAAGGGCGATGTCCGGAAGCAGCTCTCAGATCACCTCGCCGAGATACTAAGC
CCGGAGCTCACTTCTGACGGTGAACTGACAATTGATCACTTATGCGACATGCAATCCGGCATGCGCGACTACTGG
GCTATGACCACACTATGGGGGTCCAAACCCGACGATGAGTTCCTGATAGCTAGAGACTGCGGCCCACTGCTTGCC
CGAACCAAGTCATTCATGTTCCAGCCGGGAACGGAGTATTCCTACTGCAATGTCAATTTCCACGTCCTTGCCCGA
ATCATCGAGCGAGCTACGGGCGAGTCTCTTGCCAAATTGCTCGAAGAGCGGATACTCCGACCGGCTGGTATGAGC
ACGGCATTCCTTTGCCCCAACACCGCACATCACCCACCGCCCTGTGTCGGGTATGAGGGCGACGAGCAGCACGGC
TTCACGGCCGCTGTCAATAGGATGGAATGGTCCGGTGATGCTGGACTAGTGGCTTCACTCGCTGATATGATCGAG
TACGAGAAGTATCTCGATCGCTGTTACGCTGATCCGCAGAGCTGGTACCACACCGCGATCGCTGCTCCGAAGTTT
AAAGATGGCACTCCTGCAAAATACCGTTATGGGCTAGATCACGCTGACATCGCTGGCGTGAACACCATTGGACAC
GGTGGAGCGTTGCGAGGGTATCGACTGCATCGGCGACACGCTCCACGCGAGCGTTTGTCCGTCGTTGTTATGTCT
AACAGTGACTTCGGTGCATTCGGCCCCAATATGGAGATCCTCCACGAGCTCTTGGGAATACCTAAGCCTGTGGCA
TCAACCGTCCAGCCGGCCGCGGACTGGGTCGGCGCGTTTCTTGATCAAGATACTCAGCTGTCGATTGTCATCACC
AAGGGCGCGCGGGATGGAGAGGTGGCTATCAGATACGACGGGTCGGCCGAGCCTATCAAGCTTAGTGCACCGAAT
CATGGGAAGTCCGATTCCATGGTCGCGACGATTGATGGAGATTTTTTGAGTATTCATCGTGTGGTAGATAACCGG
ATACTCAGTGCTCGGCGTATTGTCCCGAAAGAGTCAATCCTTAAAGGGACTTCATTCCAGGGTGTCTATCACTGT
GCCGAGATTGAATCTACCTTCCATTGCATTGGCGAGGATGGCATGCTATATGGTGCGTTCGATGGATATCTGGGT
CAAGGAATTGCAACTCCCATGAAATATCTGGGAGATGATGTCTGGGTGTTGACTTGCCCACGTGGTTTGGATGCG
CCAGCTCCGGGAGACTGGACCGTTGTCTTTTCTCGGGATGAGCATGATGCAATCCAAGGGTTTACTATTGGTTGT
TGGTTGGCTAGGAAAGTTGACTATGTGAAGAGAGCCTGA
Gene >Pro_DTO377G3_2|g974.t1
ATGGCAATTGACGAAAAGGTTCAAGCGGTCTTGAACAAAACGGTCCTGCGTTATCGCGGCCCAGGAGGTGCCATC
GCCGTCGTCAAAGATGGCGAGGTCATCGGCCAGCGTGTCTGGGGATTCGCCGATCTCGACCAGCGAATTCCCATG
ACAGCTCAAACGCAAATCCCCATCTGTTCAATTACAAAACAATTTGTGTGTGCGTTGTTGATCGACCTGGAGCGC
AATCCAACCCCAACACTAGCTGCAAAGGGCGATGTCCGGAAGCAGCTCTCAGATCACCTCGCCGAGATACTAAGC
CCGGAGCTCACTTCTGACGGTGAACTGACAATTGATCACTTATGCGACATGCAATCCGGCATGCGCGACTACTGG
GCTATGACCACACTATGGGGGTCCAAACCCGACGATGAGTTCCTGATAGCTAGAGACTGCGGCCCACTGCTTGCC
CGAACCAAGTCATTCATGTTCCAGCCGGGAACGGAGTATTCCTACTGCAATGTCAATTTCCACGTCCTTGCCCGA
ATCATCGAGCGAGCTACGGGCGAGTCTCTTGCCAAATTGCTCGAAGAGCGGATACTCCGACCGGCTGGTATGAGC
ACGGCATTCCTTTGCCCCAACACCGCACATCACCCACCGCCCTGTGTCGGGTATGAGGGCGACGAGCAGCACGGC
TTCACGGCCGCTGTCAATAGGATGGAATGGTCCGGTGATGCTGGACTAGTGGCTTCACTCGCTGATATGATCGAG
TACGAGAAGTATCTCGATCGCTGTTACGCTGATCCGCAGAGCTGGTACCACACCGCGATCGCTGCTCCGAAGTTT
AAAGATGGCACTCCTGCAAAATACCGTTATGGGCTAGATCACGCTGACATCGCTGGCGTGAACACCATTGGACAC
GGTGGAGCGTTGCGAGGGTATCGACTGCATCGGCGACACGCTCCACGCGAGCGTTTGTCCGTCGTTGTTATGTCT
AACAGTGACTTCGGTGCATTCGGCCCCAATATGGAGATCCTCCACGAGCTCTTGGGAATACCTAAGCCTGTGGCA
TCAACCGTCCAGCCGGCCGCGGACTGGGTCGGCGCGTTTCTTGATCAAGATACTCAGCTGTCGATTGTCATCACC
AAGGGCGCGCGGGATGGAGAGGTGGCTATCAGATACGACGGGTCGGCCGAGCCTATCAAGCTTAGTGCACCGAAT
CATGGGAAGTCCGATTCCATGGTCGCGACGATTGATGGAGATTTTTTGAGTATTCATCGTGTGGTAGATAACCGG
ATACTCAGTGCTCGGCGTATTGTCCCGAAAGAGTCAATCCTTAAAGGGACTTCATTCCAGGGTGTCTATCACTGT
GCCGAGATTGAATCTACCTTCCATTGCATTGGCGAGGATGGCATGCTATATGGTGCGTTCGATGGATATCTGGGT
CAAGGAATTGCAACTCCCATGAAATATCTGGGAGATGATGTCTGGGTGTTGACTTGCCCACGTGGTTTGGATGCG
CCAGCTCCGGGAGACTGGACCGTTGTCTTTTCTCGGGATGAGCATGATGCAATCCAAGGGTTTACTATTGGTTGT
TGGTTGGCTAGGAAAGTTGACTATGTGAAGAGAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail