Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g972.t1
Gene name
Locationscaffold_01:2576503..2578357
Strand-
Gene length (bp)1854
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11700 ATG22 Vacuole effluxer Atg22 like 6.6E-132 37 501

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 91 113 22
3 118 140 22
4 150 172 22
5 210 232 22
6 247 269 22
7 306 328 22
8 338 360 22
9 373 395 22
10 405 427 22
11 440 462 22
12 472 494 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g972.t1
MDQQKDNIHSTVEVDGLPQNKIDDPIAPDVFDERYRTTRTEIWAYYAYYIGNNGLSLFNFAPTAFQNLLSQAVPA
DGLLDFLGRPRNVNSIVLLSNGISFAIQVVVFLIIGSFADFGYWRPNILIALSIIAWGIGFGWLGVHTPDKWRIG
VGLYMVGLIAYQTTLTFWTAAFPGLARNSIELKEEADKYVAGSITREEYDYADTMMRSKLANVAFYVQSVGEIFI
LAIIVGIMFGLKVNDSETNNNWGVSVLIAFVSGVWLLVSIPWFILEKRRPGQDPGKRSIFVAGMWQLWHAMKQIW
HLKQSLCYLVGYFLLGDSLNTTVTVIGTLQNSIVSYNTLELTYLLIVGIAAQGAGIYAFWTIQQRFRLGTKTMFN
AVAVGIILLDGWGMIGIWTQRFGFHHAWEVWVYQAFYGLFICPWYSYSQIMISEVTPRGHEFLFFSLFSIIGKTS
SFIGPIVSSAIIDASPSGNVSLPFYFLFGLSVASFLILFWGVDLKKSQEEQQRFLSDKLRRLNASASSSDDETSA
AV*
Coding >Pro_DTO377G3_2|g972.t1
ATGGATCAACAGAAAGACAATATCCATTCCACTGTGGAGGTGGATGGTCTTCCCCAAAACAAGATCGACGACCCG
ATTGCACCGGATGTATTTGACGAGAGATATCGCACGACCCGGACGGAAATCTGGGCTTATTATGCCTATTACATT
GGAAATAATGGCTTGTCACTATTCAACTTCGCACCGACTGCTTTTCAAAACTTGCTCTCCCAGGCAGTCCCTGCC
GATGGACTACTCGACTTTCTCGGTAGACCACGTAATGTCAACAGCATCGTGCTCCTCTCCAATGGAATCTCGTTC
GCCATCCAAGTCGTGGTGTTCCTCATAATCGGCAGTTTCGCCGATTTCGGTTACTGGCGACCCAACATCTTGATT
GCGCTGTCGATTATTGCCTGGGGCATTGGCTTCGGCTGGTTGGGTGTCCATACCCCGGATAAGTGGCGTATCGGC
GTGGGTCTATACATGGTAGGCTTGATCGCCTATCAAACCACGCTCACTTTCTGGACCGCTGCGTTCCCGGGCTTA
GCGCGCAACTCCATCGAATTGAAGGAAGAGGCCGACAAATATGTGGCCGGGAGCATCACTCGGGAGGAATATGAC
TATGCGGACACCATGATGCGCAGCAAACTTGCCAATGTCGCTTTCTATGTTCAGTCCGTTGGAGAGATCTTTATC
TTGGCCATTATCGTGGGCATCATGTTCGGGTTGAAGGTCAATGATAGCGAGACTAATAACAACTGGGGAGTGAGT
GTGCTGATCGCATTCGTCTCTGGTGTGTGGTTGCTCGTCTCGATTCCGTGGTTTATTCTTGAGAAACGCCGTCCG
GGTCAAGACCCTGGCAAACGGTCGATCTTTGTTGCAGGCATGTGGCAGCTGTGGCATGCTATGAAGCAGATCTGG
CATTTAAAGCAGAGTCTGTGCTATCTAGTTGGTTATTTCTTACTTGGAGACTCTCTCAACACCACTGTGACTGTT
ATTGGAACTTTGCAGAACAGCATCGTTTCGTATAATACTCTGGAACTGACATACCTGCTTATTGTTGGCATTGCT
GCACAGGGTGCTGGCATATACGCATTCTGGACAATCCAGCAACGCTTCAGGCTCGGAACCAAAACTATGTTCAAC
GCCGTCGCCGTTGGAATCATCCTACTTGATGGCTGGGGCATGATCGGTATCTGGACCCAGAGGTTCGGCTTCCAT
CATGCATGGGAAGTCTGGGTCTACCAAGCGTTCTACGGCCTTTTCATCTGTCCCTGGTACAGCTACTCGCAAATT
ATGATTTCAGAGGTTACACCCCGCGGTCACGAGTTCCTATTCTTCAGTCTCTTCAGCATCATCGGTAAAACCTCA
TCTTTTATTGGACCCATCGTCTCAAGTGCAATTATCGACGCGAGCCCGTCGGGTAATGTCTCGTTGCCATTCTAC
TTCTTGTTTGGGTTGAGCGTTGCCAGCTTTTTGATTCTGTTCTGGGGTGTTGATTTAAAGAAGAGCCAGGAAGAG
CAGCAGAGGTTCTTGTCGGATAAGCTGCGTCGCCTGAATGCCAGCGCCTCGTCCTCTGATGACGAGACTTCCGCG
GCAGTCTGA
Transcript >Pro_DTO377G3_2|g972.t1
ATGGATCAACAGAAAGACAATATCCATTCCACTGTGGAGGTGGATGGTCTTCCCCAAAACAAGATCGACGACCCG
ATTGCACCGGATGTATTTGACGAGAGATATCGCACGACCCGGACGGAAATCTGGGCTTATTATGCCTATTACATT
GGAAATAATGGCTTGTCACTATTCAACTTCGCACCGACTGCTTTTCAAAACTTGCTCTCCCAGGCAGTCCCTGCC
GATGGACTACTCGACTTTCTCGGTAGACCACGTAATGTCAACAGCATCGTGCTCCTCTCCAATGGAATCTCGTTC
GCCATCCAAGTCGTGGTGTTCCTCATAATCGGCAGTTTCGCCGATTTCGGTTACTGGCGACCCAACATCTTGATT
GCGCTGTCGATTATTGCCTGGGGCATTGGCTTCGGCTGGTTGGGTGTCCATACCCCGGATAAGTGGCGTATCGGC
GTGGGTCTATACATGGTAGGCTTGATCGCCTATCAAACCACGCTCACTTTCTGGACCGCTGCGTTCCCGGGCTTA
GCGCGCAACTCCATCGAATTGAAGGAAGAGGCCGACAAATATGTGGCCGGGAGCATCACTCGGGAGGAATATGAC
TATGCGGACACCATGATGCGCAGCAAACTTGCCAATGTCGCTTTCTATGTTCAGTCCGTTGGAGAGATCTTTATC
TTGGCCATTATCGTGGGCATCATGTTCGGGTTGAAGGTCAATGATAGCGAGACTAATAACAACTGGGGAGTGAGT
GTGCTGATCGCATTCGTCTCTGGTGTGTGGTTGCTCGTCTCGATTCCGTGGTTTATTCTTGAGAAACGCCGTCCG
GGTCAAGACCCTGGCAAACGGTCGATCTTTGTTGCAGGCATGTGGCAGCTGTGGCATGCTATGAAGCAGATCTGG
CATTTAAAGCAGAGTCTGTGCTATCTAGTTGGTTATTTCTTACTTGGAGACTCTCTCAACACCACTGTGACTGTT
ATTGGAACTTTGCAGAACAGCATCGTTTCGTATAATACTCTGGAACTGACATACCTGCTTATTGTTGGCATTGCT
GCACAGGGTGCTGGCATATACGCATTCTGGACAATCCAGCAACGCTTCAGGCTCGGAACCAAAACTATGTTCAAC
GCCGTCGCCGTTGGAATCATCCTACTTGATGGCTGGGGCATGATCGGTATCTGGACCCAGAGGTTCGGCTTCCAT
CATGCATGGGAAGTCTGGGTCTACCAAGCGTTCTACGGCCTTTTCATCTGTCCCTGGTACAGCTACTCGCAAATT
ATGATTTCAGAGGTTACACCCCGCGGTCACGAGTTCCTATTCTTCAGTCTCTTCAGCATCATCGGTAAAACCTCA
TCTTTTATTGGACCCATCGTCTCAAGTGCAATTATCGACGCGAGCCCGTCGGGTAATGTCTCGTTGCCATTCTAC
TTCTTGTTTGGGTTGAGCGTTGCCAGCTTTTTGATTCTGTTCTGGGGTGTTGATTTAAAGAAGAGCCAGGAAGAG
CAGCAGAGGTTCTTGTCGGATAAGCTGCGTCGCCTGAATGCCAGCGCCTCGTCCTCTGATGACGAGACTTCCGCG
GCAGTCTGA
Gene >Pro_DTO377G3_2|g972.t1
ATGGATCAACAGAAAGACAATATCCATTCCACTGTGGAGGTGGATGGTCTTCCCCAAAACAAGATCGACGACCCG
ATTGCACCGGATGTATTTGACGAGAGATATCGCACGACCCGGACGGAAATCTGGGCTTATTATGCGTGCGTGGCT
TGTTGAATTGACCCTGTGTGGAAACTAAACCACGATTGCAGCTATTACATTGGAAATAATGGCTTGTCACTATTC
AGTGGGTCTATCCGCGTTCCCAATCTAATATTGAGGCAGGAGCTGACCCCGTTCTAGACTTCGCACCGACTGCTT
TTCAAAACTTGCTCTCCCAGGCAGTCCCTGCCGATGGACTACTCGACTTTCTCGGTAGACCACGTAATGTCAACA
GCATCGTGCTCCTCTCCAATGGAATCTCGTTCGCCATCCAAGTCGTGGTGTTCCTCATAATCGGCAGTTTCGCCG
ATTTCGGTTACTGGCGACCCAACATCTTGATTGCGCTGTCGATTATTGCCTGGGGCATTGGCTTCGGCTGGTTGG
GTGTCCATACCCCGGATAAGTGGCGTATCGGCGTGGGTCTATACATGGTAGGCTTGATCGCCTATCAAACCACGC
TCACTTTCTGGACCGCTGCGTTCCCGGGCTTAGCGCGCAACTCCATCGAATTGAAGGAAGAGGCCGACAAATATG
TGGCCGGGAGCATCACTCGGGAGGAATATGACTATGCGGACACCATGATGCGCAGCAAACTTGCCAATGTCGCTT
TCTATGTTCAGTCCGTTGGAGAGATCTTTATCTTGGCCATTATCGTGGGCATCATGTTCGGGTTGAAGGTCAATG
ATAGCGAGACTAATAACAACTGGGGAGTGAGTGTGCTGATCGCATTCGTCTCTGGTGTGTGGTTGCTCGTCTCGA
TTCCGTGGTTTATTCTTGAGAAACGCCGTCCGGGTCAAGACCCTGGCAAACGGTCGATCTTTGTTGCAGGCATGT
GGCAGCTGTGGCATGCTATGAAGCAGATCTGGCATTTAAAGCAGAGTCTGTGCTATCTAGTTGGTAAGACTTTTT
ATCCTACTATCTCTGTGATTATACGGGGCTAACGGTGGCAATAGGTTATTTCTTACTTGGAGACTCTCTCAACAC
CACTGTGACTGTTATTGGAACTTTGCAGAACAGCATCGTTTCGTATAATACTCTGGAACTGACATACCTGCTTAT
TGTTGGCATTGCTGCACAGGTGAGTCTAATTCCGCGAGCGAAATTGTTCCAAACTAACAAATCTCTCTTAGGGTG
CTGGCATATACGCATTCTGGACAATCCAGCAACGCTTCAGGCTCGGAACCAAAACTATGTTCAACGCCGTCGCCG
TTGGAATCATCCTACTTGATGGCTGGGGCATGATCGGTATCTGGACCCAGAGGTTCGGCTTCCATCATGCATGGG
AAGTCTGGGTATGTCAATCCCGCTCTGCCATATGATGCGTAATATCTAACTGATTGATTATAGGTCTACCAAGCG
TTCTACGGCCTTTTCATCTGTCCCTGGTACAGCTACTCGCAAATTATGATTTCAGAGGTTACACCCCGCGGTCAC
GAGTTCCTATTCTTCAGTCTCTTCAGCATCATCGGTAAAACCTCATCTTTTATTGGACCCATCGTCTCAAGTGCA
ATTATCGACGCGAGCCCGTCGGGTAATGTCTCGTTGCCATTCTACTTCTTGTTTGGGTTGAGCGTTGCCAGCTTT
TTGATTCTGTTCTGGGGTGTTGATTTAAAGAAGAGCCAGGAAGAGCAGCAGAGGTTCTTGTCGGATAAGCTGCGT
CGCCTGAATGCCAGCGCCTCGTCCTCTGATGACGAGACTTCCGCGGCAGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail