Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9689.t1
Gene name
Locationscaffold_61:28059..28917
Strand-
Gene length (bp)858
Transcript length (bp)858
Coding sequence length (bp)858
Protein length (aa) 286

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11807 DUF3328 Domain of unknown function (DUF3328) 2.4E-23 74 228

GO

GO Term Description Terminal node
GO:0043386 mycotoxin biosynthetic process Yes
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043385 mycotoxin metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0019748 secondary metabolic process No
GO:0009404 toxin metabolic process No
GO:0044550 secondary metabolite biosynthetic process No
GO:0009403 toxin biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9689.t1
MRTTPSENREEFAGLLNNIDKTSQDPNISADGPGNSNPYRQRFLFLIPILLLSLITNIITISIIAANPEPYRTHS
KYADLHLTHTEPYVLLTDYSSPNTTLADTLWHSINIDSGVVALPDSFATSHNLRTAQRFPWDTSKGIYILHGFHN
LHCLKIIYISLFEFREGQTQTRTWHHIAHCLDALRRQIICDADDTPRATERRVEVVSGVGQNRVCRNWGELENWA
KAHTSCYRRPEKPEDETGLKRFMHCPEGSGYVVDEGYVPEEEILVGLPEESIATGLAGEV*
Coding >Pro_DTO377G3_2|g9689.t1
ATGAGGACGACACCATCTGAGAATAGGGAAGAATTCGCCGGTCTTCTCAACAATATTGACAAGACGAGCCAGGAT
CCAAACATCTCTGCAGATGGCCCTGGAAACTCGAACCCCTACAGGCAGCGATTCCTCTTCCTAATTCCTATACTG
CTTCTATCTCTTATCACCAATATAATCACCATCTCCATCATCGCCGCAAACCCCGAACCCTATAGAACTCATTCA
AAATACGCCGACCTCCACCTCACTCACACAGAGCCCTACGTCCTCCTAACCGATTACTCCTCCCCAAATACCACC
CTTGCGGATACCCTATGGCACTCCATAAACATCGACAGCGGCGTTGTTGCCCTCCCAGACTCCTTCGCTACATCC
CACAACCTCCGCACAGCGCAGCGCTTTCCCTGGGACACCAGCAAAGGAATCTACATCCTCCATGGCTTCCACAAT
CTGCACTGTCTTAAGATCATCTATATCAGCCTTTTCGAGTTTCGGGAAGGCCAGACACAGACGAGAACCTGGCAC
CATATCGCGCATTGTCTTGATGCGCTGAGGCGACAGATTATATGTGATGCGGATGATACACCTCGGGCTACGGAG
AGAAGGGTCGAGGTTGTTAGTGGAGTTGGGCAGAATCGGGTTTGTCGGAACTGGGGGGAGTTGGAAAATTGGGCG
AAAGCTCATACGTCTTGTTATAGACGGCCTGAGAAGCCGGAGGATGAGACTGGGTTGAAAAGGTTTATGCATTGT
CCAGAGGGGAGTGGCTACGTGGTTGATGAGGGGTATGTACCCGAGGAGGAGATCTTGGTCGGGTTACCTGAAGAG
TCGATTGCGACAGGGCTGGCTGGGGAGGTATAG
Transcript >Pro_DTO377G3_2|g9689.t1
ATGAGGACGACACCATCTGAGAATAGGGAAGAATTCGCCGGTCTTCTCAACAATATTGACAAGACGAGCCAGGAT
CCAAACATCTCTGCAGATGGCCCTGGAAACTCGAACCCCTACAGGCAGCGATTCCTCTTCCTAATTCCTATACTG
CTTCTATCTCTTATCACCAATATAATCACCATCTCCATCATCGCCGCAAACCCCGAACCCTATAGAACTCATTCA
AAATACGCCGACCTCCACCTCACTCACACAGAGCCCTACGTCCTCCTAACCGATTACTCCTCCCCAAATACCACC
CTTGCGGATACCCTATGGCACTCCATAAACATCGACAGCGGCGTTGTTGCCCTCCCAGACTCCTTCGCTACATCC
CACAACCTCCGCACAGCGCAGCGCTTTCCCTGGGACACCAGCAAAGGAATCTACATCCTCCATGGCTTCCACAAT
CTGCACTGTCTTAAGATCATCTATATCAGCCTTTTCGAGTTTCGGGAAGGCCAGACACAGACGAGAACCTGGCAC
CATATCGCGCATTGTCTTGATGCGCTGAGGCGACAGATTATATGTGATGCGGATGATACACCTCGGGCTACGGAG
AGAAGGGTCGAGGTTGTTAGTGGAGTTGGGCAGAATCGGGTTTGTCGGAACTGGGGGGAGTTGGAAAATTGGGCG
AAAGCTCATACGTCTTGTTATAGACGGCCTGAGAAGCCGGAGGATGAGACTGGGTTGAAAAGGTTTATGCATTGT
CCAGAGGGGAGTGGCTACGTGGTTGATGAGGGGTATGTACCCGAGGAGGAGATCTTGGTCGGGTTACCTGAAGAG
TCGATTGCGACAGGGCTGGCTGGGGAGGTATAG
Gene >Pro_DTO377G3_2|g9689.t1
ATGAGGACGACACCATCTGAGAATAGGGAAGAATTCGCCGGTCTTCTCAACAATATTGACAAGACGAGCCAGGAT
CCAAACATCTCTGCAGATGGCCCTGGAAACTCGAACCCCTACAGGCAGCGATTCCTCTTCCTAATTCCTATACTG
CTTCTATCTCTTATCACCAATATAATCACCATCTCCATCATCGCCGCAAACCCCGAACCCTATAGAACTCATTCA
AAATACGCCGACCTCCACCTCACTCACACAGAGCCCTACGTCCTCCTAACCGATTACTCCTCCCCAAATACCACC
CTTGCGGATACCCTATGGCACTCCATAAACATCGACAGCGGCGTTGTTGCCCTCCCAGACTCCTTCGCTACATCC
CACAACCTCCGCACAGCGCAGCGCTTTCCCTGGGACACCAGCAAAGGAATCTACATCCTCCATGGCTTCCACAAT
CTGCACTGTCTTAAGATCATCTATATCAGCCTTTTCGAGTTTCGGGAAGGCCAGACACAGACGAGAACCTGGCAC
CATATCGCGCATTGTCTTGATGCGCTGAGGCGACAGATTATATGTGATGCGGATGATACACCTCGGGCTACGGAG
AGAAGGGTCGAGGTTGTTAGTGGAGTTGGGCAGAATCGGGTTTGTCGGAACTGGGGGGAGTTGGAAAATTGGGCG
AAAGCTCATACGTCTTGTTATAGACGGCCTGAGAAGCCGGAGGATGAGACTGGGTTGAAAAGGTTTATGCATTGT
CCAGAGGGGAGTGGCTACGTGGTTGATGAGGGGTATGTACCCGAGGAGGAGATCTTGGTCGGGTTACCTGAAGAG
TCGATTGCGACAGGGCTGGCTGGGGAGGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail