Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9665.t1
Gene name
Locationscaffold_58:2199..17016
Strand-
Gene length (bp)14817
Transcript length (bp)14763
Coding sequence length (bp)14763
Protein length (aa) 4921

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07728 AAA_5 AAA domain (dynein-related subfamily) 9.5E-18 298 419
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.1E-07 633 679
PF07728 AAA_5 AAA domain (dynein-related subfamily) 5.1E-08 795 884
PF07728 AAA_5 AAA domain (dynein-related subfamily) 6.9E-22 1068 1204
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.1E-06 1358 1407
PF07728 AAA_5 AAA domain (dynein-related subfamily) 3.9E-11 1466 1555
PF07728 AAA_5 AAA domain (dynein-related subfamily) 4.9E-19 1737 1875
PF07728 AAA_5 AAA domain (dynein-related subfamily) 5.6E-06 2046 2094
PF07728 AAA_5 AAA domain (dynein-related subfamily) 8.3E-08 2182 2270
PF17867 AAA_lid_7 Midasin AAA lid domain 1.3E-17 450 562
PF17867 AAA_lid_7 Midasin AAA lid domain 5.8E-11 1216 1309
PF17867 AAA_lid_7 Midasin AAA lid domain 2.2E-11 1887 1983
PF07726 AAA_3 ATPase family associated with various cellular activities (AAA) 7.8E-05 1069 1205
PF07726 AAA_3 ATPase family associated with various cellular activities (AAA) 8.7E-11 1737 1876
PF17865 AAA_lid_5 Midasin AAA lid domain 1.4E-27 898 999
PF00004 AAA ATPase family associated with various cellular activities (AAA) 2.8E-04 1737 1771
PF03028 Dynein_heavy Dynein heavy chain region D6 P-loop domain 2.9E-05 2189 2271

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0030286 dynein complex Yes
GO:0003777 microtubule motor activity Yes
GO:0016887 ATPase activity Yes
GO:0007018 microtubule-based movement Yes
GO:0097367 carbohydrate derivative binding No
GO:0005875 microtubule associated complex No
GO:0017076 purine nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0009987 cellular process No
GO:0043168 anion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032553 ribonucleotide binding No
GO:0044446 intracellular organelle part No
GO:0016462 pyrophosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0006928 movement of cell or subcellular component No
GO:0044464 cell part No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:1902494 catalytic complex No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0005488 binding No
GO:0044424 intracellular part No
GO:0003774 motor activity No
GO:0044422 organelle part No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:0008144 drug binding No
GO:0008150 biological_process No
GO:0044430 cytoskeletal part No
GO:0016787 hydrolase activity No
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No
GO:0007017 microtubule-based process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9665.t1
MDRRPVYERTLTESELLEQLPSGISTFIRTASGTQHLHALALGALNNEFTESIFRLYEPIFVDLAARWLQSDLHA
DYIHVLAAFAQILPFAPHLRSLASQYASSQTGPLVALAVSKELTLLQLDQVSIRLLLLALFRLLSFDLETFSPII
SPLQLQSLFQSQDRVTRYLAVRCFALYMHAADAATEKMVRVNTGTEPIEGEWEGTLIDYRVLGLWEERRWETLGG
IIRAERTSRTENNTLALIERTRDSFTTKTAEICGVLIPRLKDTPAAPSSVVKTTTTVENLRRIAGSLLGYKPILL
VGLPNSGKTSLINDIAATMGQIETMVTLHLNEQTDAKSLLGMYATSSASGSFSWQPGVLTKAAREGRWVLIEDLD
RAPSEVMGLILPIIERGELTIPSRRERIKCAEGFKIIATMKSSYNIAGEEIAPSNSMLGSRLWERVQVKSLPVDE
MRDVILQKFSLLESRVPTLMNVYGRVCSAFHGSLAIKGSQGRTPGFRDLIKLCNRLHNRLHRIGAKTGYEPTSEG
TEDEIFLDIVDVFLRYLPEKSMQSTLAAVVAEALQISPQRAQYCLNERTPSYIDKNNSLVLGRETCNKIKVPSGS
ALKLAAAASRFAPTRAALTLMEQVAASIQMAEPVLLVGETGIGKTTVIQHLASLMRQKLTVVNLSQQSESTDLLG
GFKPVNIRTMAVPMLDEFTQLFELTFSAKKNQKFLSSISKSAASSNWVRLVTLWHEAVRLANGVFNPSNATGENG
DEQPAKKRKLDSPKYQHLRQRWESFATQLGDFEAQVSQGDAKFAFAFVQGKIVRALRNGEWVLLDEVNLASPDTL
ENIASLLHHGSEGTPSVLLSEAGDVERVFGHPEFRIFGAMNPATDAGKRDLPPGLRSRFTEFYVHSPDSDLDDLL
ALIQKYLGDLTISDQRAVPDLAQLYMVTKKLSNENKLTDGAGQRPHFSIRTLVRALIYVIDHAHVYGLRRAMFEG
FSMSFLTVLSLVSERALIPLLELHIFGNAKNAKSLLGQTPRPPTDGNDYVQFKHYWMRRGPMLPEEQPHYIITPF
IEKNLKNLVRASSTRRFPVLLQGPTSAGKTSMIEYLAKVSGNKFVRINNHEHTDLQEYLGSYISSDDGSLRYQEG
VLVEALRNGYWIVLDELNLAPSDVLEALNRLLDDNRELFIPETQEVVHPHPNFMLFATQNPAGLYGGRKVLSRAF
RNRFLELHFDDIPESELEFILKERSQIAPSFCTRIVEVYRKLSLLRQSNRLFEQKNSFATLRDLFRWALRDADDR
EQLAVNGYMLLGERVRNPQEKAAVKTVIEEVMKVKLDEDTLYSSAELEKNAPEMSELPIGIVWTKAMRRLFILVS
KALKNNEPVLLVGETGCGKTQLCQAVAEAFRRELFIVNAHVNLETGDLIGAQRPIRNRAAIEKQLVDDLQILLHG
QLSGASFDDLKQEFTALTAEQRQAKDQLLLKKIEKNAIRCNALFEWSDGSLITAMKTGQFFLLDEISLADDSVLE
RLNSVLEPARSILLAEKGPVDSMVVADGGFQFLSTMNPGGDYGKRELSAALRNRMTEIWAPQLSEDEDILPILSQ
RLDLKDESVATAMLRFAKWFKVTFQNSSATSLSIRDLLAWVDFVNTCQRADTPFAIVQGAAMVFVDTLGANPAAM
LAISLNNLEGNRKSCLDKLSELFNVDASKIYWESTTVSAEPGVLRVGPFALPTAGTADPDPQFTMDAPTTIANSV
RIARGLQSSKPILMEGSPGVGKTTLVTALARALGKPLTRINLSEQTDLTDLFGSDVPVEGGDVGQFTWRDAPFLR
AMQRGDWVLLDEMNLASQSVLEGLNSCLDHRQQVYIAELDQTFKRHPDFVLFAAQNPHHQGGGRKGLPASFVNRF
TVVYADSFTDDDLKTICSRLFPGSPSVQTERLVDFISLLNQAITRDRRLGTIGGPWEVNLRDIQRWLQLADRGNL
QIQTKHFLNVVISQRFRSEEDRNVVSQIYDRVFTDSDTGSESYFHNLTPEYLQVGLGVLTRDPLLQRLAEPNMRI
LPNDLHIAESLILCIDNSWPSILVGPAGCGKTTLIRKLAAVNGANLVELALSSDTDTMDLIGGFEQIDHRREVSG
FVHDIEMFLRNQLIQCFASGDVSDVVISALQICEHFQSADISLENVIPSLSSLCQSSSDPVYQQFLERAQTLLNA
IQQSDKMKVGFEWTEGVLTQAVQHGNWVILDNANLCNPSVLDRLNSLTEPNGTLILNEQRTDDGSAKVITPHVNF
RIFLTMDPRNGELSRAMRNRCTEICFLPSEMQDIQPTIGPSYTCESFLYRLRHIWNLDTSLPSSAFEDALEVCLD
HLSPADLAYLQQSPSNRVAINSEHNGEDKPSNVLQRYTSLFHDNNQWKPLDIASGEIVLGGAHLGIRGMLQPLHP
LTNEPLIAIAGTSDFRSSLIVLAYLQELRLDIHRLREGLIQADVSGKELKPSQMTRLERSLASERIPALMKDTTQ
PVASFLSDCGQALYDYIQSLDQISLQGPVIIAALRTVICLCWDIYRATEVSQVDEGEFQVYLQMGRKICGSLLDS
SPLLNPLQVALSQALDRFQEGWALTTGLSMQRIWDSWRHVTPISQDKLNSLTELESTVFDFTTLALQTRVELSQL
SRVRNSLIDAQRFILLDGADGDVLVQGIKQTVAELSHAVRRSESTEYPYFANDFEALCQYHDISSFFQNPVHDTV
IQTVLPLLAGRAARPLDTSNFQSDVPNILHRISLFAGSSSKSESALATGGIISLSLLDKLATIGNTKLGQMDMLE
AEKQALSKAISLSSQQITTDQSMVLGRTIAKLTAELVACHREFFEPRSAEDLISVLQAIQNGDLCVEQSPIKVEL
DQSLPNALFFRPLAEQALPALISSLQASSQQQSIRTTGLAAVQLAVILLRLFVPDKTFDPSLGLVVQRKRHSQRL
QEYTAKSAAILAFEKSFTNQVSNLRSELLHNEIRDLGSAPPPSLVNRPQQSQLSLLQGEFVNLINTVLKRDPEQM
VRSAESSQSQDMIQLLRNNIKQLSSRLSTHYRSYDDITVPVVRFLQLLDLGVFLASSQPEQSGDIPDIQSLSART
PFLGGIHHPVLAQDDRKAPGTLKNANEMRLQELSALWAAKDADSTILNTKAGRDIIRRVFADFHQLWKTKLEEDR
ELEAEKGELYRFKGSWEEEEEVNEAELHALFPTFDEGSAEDTETTDAADRIDPKSIALRLASLHANIVSNERSGT
ALTTLVKQSGHLLGSIWSENKTSFSPMSPQNHLPAVLLLLDDAIGEGTNNHQKNYNFYTDSNLEEARKLVALALS
VQARFAQIQTAWPEHVVLADVIQCCVQILQFKHTEPVAKFMTKVEKLHSFVHEWQTVASREYSAVTVYDEITSIL
ISWRRLELSTWAKLLDIEKERCEDEVSAWWFIAYEVLIGAPIMMVEAGEQDMTEHTQNLVLTLEQFFNSTTTGQF
ARRLQLVANFQALLEVFTTDYPCLKKLVSALDNFLHHYGPFQPGVDKYLTEKRSVLEKDIKEQIQLASWKDVNIV
ALKESARRSHVKLFKLVRKYRAALGQPVQSILEAGLPESTEEITSMSQAEPVRPTATFPEAMAICQNDKKLWSTR
ALRFQKPDGTANNMMNLYSSIPAEFDIAKDLDSFIVSVIESMNEFKSKTPKVLNEDNKDDVQHLKSQKRRLYAET
LKQLYEMGVKRNAGSSVIETQETVPQVLATSAAFEAGAATSTAVQSADWYFHRLLDLLPKTRLASRNYSEELSNV
EVHRSMGSIEHLILTVRRQRGVISPALTGLGKLKSTLDKVQNLWAATSNYLSQDHASASEKRTNLARIVAWLAPI
LGLAAMIIGVHSKFSGIDASKIVEQLRAKKASFDSLRKSHEALPMLPTRIASNANHEIAQQAQSSLDELAADLKQ
WSQARPDLSFALDQITPWVKTKVADVPEVNDENSLSIQAFDSSLLTAIDKMLIGLQKLKDVPSAITFDGLLSRSD
EFFSRGIKAVHLPEITAALEKVLDQLHLLQDHSAGGLSVAAALLTSILPIANRYYQICRDLADRFIAVHREICKT
SYILTKTFKQVASEGFCSPAEASQDQGKEGQMESGTGLGEGEGAEDISKDVGDDEDLSELAQQENKKEDGDDEMD
DSKDAVNMDQEELEGDAEDRKDEEEENDDSAEEGDDDIDEETGSVDDLDPGAVDEKLWDGGNDEQQKDTENEEGK
GQSEAEQQAAAQEEKGDKDENGEEKQKEGEEEEEEETEDEEAPEDEGEAVGREEMDVTDPQAKEEETLELPEEMQ
LDDGEGKDDNGEDDDDMDDLDDDFGPAPEEEAEGKDEDVNDEAGEEDAEAAEDQVPGEEDEEMADDAEETNEGEA
GEEEEEEAGGEDPEESEQDDFLAQRDENDAAGDNVAPSEAVTGGLGAEQDQNEEKGASGDAQQESGSTDPSANVD
QQTGAAKDSEESQPSRDAAGGEDHGPDEPQMQAFKKLGDILEQWHRRQKEILNPSQQEEESQAMPQDTDMADADF
EHLKDDDDAADTQALGQANDDQTQALDQSKGVESDIKPGENDVLPDVSDEQQDAVDNQLEDEMEIDRENVPTDGE
SVGAFIPSGQSSHDRADGAQGTEEVDEELDEVDSQLAAIHLSSSLPPLTPQDEARRLWSHYESATNDLSLSLTEQ
LRLILAPTMATKLRGDFRTGKRLNIKRIIPYIASQYKRDKIWMRRSIPSKRNYQIMLAVDDSKSMLESGSGQLAF
ETLALVAKSLSMLEAGDLCVLGFGDEEHVRVAHEFGKPFSSEAGSQVFQHFSYQQTGTNVRKLIADSIALFREAR
WKRSPGSGSADLWQLQLIISDGICEDHDTIRRLVRQALEERIMVVFIIVDAVKGSSILDLSQASFEADPGSGGEM
KLKMKRYLEDFPFPYYLVVRDVKELPSVLATALKQWFAEVVDVSS*
Coding >Pro_DTO377G3_2|g9665.t1
ATGGATCGGAGGCCGGTCTATGAGAGGACTCTTACTGAGTCCGAACTTCTCGAGCAGCTTCCGAGTGGAATCTCG
ACTTTCATTCGGACTGCATCGGGGACGCAACACCTCCACGCTCTTGCGCTTGGCGCATTAAACAACGAATTTACA
GAGAGCATTTTCAGACTATACGAACCGATTTTCGTCGATCTTGCAGCTAGATGGCTTCAATCGGATTTACATGCC
GACTACATTCATGTATTAGCGGCATTCGCGCAGATTTTACCATTTGCGCCGCACCTGCGCTCGCTTGCCAGTCAA
TATGCCTCATCACAGACTGGACCTTTGGTGGCTTTGGCCGTGTCGAAGGAATTAACACTGCTACAATTGGATCAA
GTTAGCATTAGACTTCTACTCCTCGCCCTCTTCCGACTTCTTTCATTTGATCTTGAAACCTTCTCTCCCATCATT
TCACCGCTTCAACTGCAGTCCCTCTTCCAATCCCAAGATCGAGTAACACGATACCTTGCTGTACGATGCTTTGCC
TTATATATGCACGCAGCCGATGCGGCAACCGAAAAGATGGTCCGCGTCAATACCGGGACTGAGCCTATAGAAGGA
GAGTGGGAAGGCACTCTGATCGATTACCGTGTGCTAGGATTGTGGGAAGAACGCCGATGGGAGACTCTTGGGGGA
ATTATTCGGGCCGAGAGGACTTCCAGGACGGAAAACAACACCCTGGCGTTGATCGAGAGGACACGGGACTCTTTC
ACAACCAAGACCGCAGAAATCTGCGGTGTTTTGATTCCCAGGTTGAAAGATACACCCGCGGCTCCTTCGTCTGTC
GTCAAGACTACTACCACAGTTGAAAATCTGCGCCGAATTGCAGGGTCATTACTCGGTTACAAACCCATCCTGCTG
GTCGGTTTGCCCAACTCCGGGAAGACCTCTTTGATTAATGATATTGCTGCCACGATGGGCCAGATTGAAACTATG
GTCACACTTCACTTGAACGAACAGACAGATGCGAAGAGTCTGCTTGGAATGTATGCCACTTCATCTGCCTCCGGA
TCATTTTCTTGGCAGCCTGGTGTATTGACCAAGGCTGCACGCGAAGGTCGCTGGGTGTTGATTGAAGACCTTGAT
CGTGCTCCATCTGAAGTAATGGGCCTCATTCTCCCGATCATTGAGAGGGGCGAGCTCACTATCCCGAGCAGGAGG
GAGCGAATCAAGTGTGCCGAGGGCTTCAAAATCATCGCAACCATGAAGTCATCGTACAACATTGCCGGCGAGGAG
ATCGCACCGAGCAATTCAATGCTCGGAAGCAGACTCTGGGAGAGAGTGCAAGTCAAGTCTCTTCCCGTGGATGAG
ATGCGTGATGTCATCCTGCAAAAGTTCTCTTTGCTTGAGTCTCGTGTGCCAACTCTCATGAACGTCTACGGACGA
GTATGCTCTGCATTCCATGGAAGTCTTGCGATCAAGGGCTCTCAAGGCCGTACCCCGGGCTTCCGCGATTTGATC
AAGTTGTGCAACCGTCTGCACAATCGCCTACACCGCATAGGTGCGAAGACTGGCTATGAGCCCACGTCAGAAGGT
ACCGAGGATGAAATATTCCTCGACATTGTTGACGTGTTCCTCCGGTATCTGCCCGAGAAGTCAATGCAAAGCACT
CTCGCCGCCGTTGTGGCCGAAGCGCTTCAAATTTCTCCCCAGCGAGCGCAATATTGTCTCAATGAACGCACCCCC
TCTTATATCGACAAGAACAACAGCCTTGTTCTTGGCAGAGAAACCTGTAACAAGATCAAAGTACCAAGTGGATCT
GCATTGAAGCTTGCCGCAGCAGCTTCACGATTTGCCCCCACCCGAGCGGCATTAACCCTCATGGAACAGGTAGCT
GCCTCAATCCAGATGGCAGAGCCTGTTTTACTTGTTGGAGAAACTGGTATCGGAAAGACCACGGTCATCCAGCAT
CTTGCATCTTTGATGCGTCAGAAACTCACAGTAGTAAATTTGTCACAACAGAGTGAAAGCACTGATCTGCTGGGT
GGTTTCAAACCCGTCAACATCCGTACAATGGCAGTTCCAATGCTCGATGAATTCACTCAGCTCTTTGAACTGACT
TTCTCGGCCAAAAAGAACCAGAAGTTCTTGTCGTCCATATCGAAGAGTGCCGCGTCTTCCAATTGGGTACGATTG
GTGACCTTGTGGCACGAAGCCGTTCGTCTTGCAAATGGAGTGTTCAATCCCTCGAATGCCACAGGGGAGAATGGC
GATGAACAGCCAGCCAAAAAACGGAAGCTGGATTCTCCCAAATACCAGCACTTGCGGCAAAGATGGGAGAGCTTC
GCAACACAGCTCGGAGATTTCGAGGCTCAGGTCTCACAAGGTGATGCCAAATTTGCCTTTGCCTTTGTCCAAGGT
AAGATTGTGAGAGCCCTACGAAACGGCGAATGGGTCCTCCTGGATGAAGTGAACTTGGCTTCCCCTGATACCCTT
GAGAATATTGCCAGTCTTCTGCACCACGGAAGTGAGGGAACGCCATCTGTTCTCCTCTCCGAGGCTGGCGATGTT
GAGAGAGTCTTCGGCCACCCGGAATTCCGTATCTTCGGTGCTATGAACCCTGCAACAGATGCTGGAAAGAGAGAC
CTTCCCCCCGGTTTGCGTTCTCGGTTCACCGAATTCTACGTACACTCACCCGATAGCGACTTGGATGATTTATTG
GCTTTGATCCAGAAATACCTTGGTGATTTGACAATCAGTGACCAGCGTGCCGTGCCAGACCTCGCACAGCTTTAC
ATGGTGACCAAGAAGCTCAGCAACGAGAACAAGCTTACTGATGGAGCTGGACAGCGACCTCATTTCAGTATCCGT
ACTCTTGTGCGGGCCTTGATCTATGTCATCGACCACGCACATGTCTACGGGCTACGCAGGGCAATGTTTGAGGGT
TTTAGTATGAGTTTCTTGACCGTGCTGAGCTTGGTCTCCGAACGGGCTTTGATACCTCTACTTGAGCTTCATATC
TTTGGGAACGCGAAGAACGCCAAGTCTCTTCTCGGACAGACCCCCCGCCCACCAACTGATGGCAATGATTATGTG
CAATTCAAACATTACTGGATGCGCCGCGGTCCTATGCTCCCGGAGGAGCAGCCACACTACATTATCACCCCATTC
ATTGAGAAGAATCTGAAGAACTTAGTCCGGGCTAGTTCAACTCGGCGATTCCCCGTTCTGCTCCAGGGTCCGACA
TCAGCCGGAAAGACGAGTATGATCGAGTATCTGGCAAAGGTGTCTGGAAACAAATTTGTACGAATTAACAATCAC
GAGCATACAGATCTGCAAGAGTACCTAGGGTCTTACATCTCGTCAGACGATGGAAGCCTGCGTTATCAAGAGGGT
GTGTTGGTGGAGGCGCTGCGGAACGGTTATTGGATTGTGCTGGATGAGCTGAATCTAGCGCCTTCTGATGTTCTT
GAAGCCCTTAACCGACTCCTCGATGATAATCGTGAGCTTTTCATTCCCGAAACTCAAGAAGTTGTCCACCCGCAT
CCGAACTTCATGCTGTTTGCCACGCAAAATCCCGCTGGTCTGTACGGTGGCCGAAAGGTCCTATCCCGTGCCTTC
AGGAACCGTTTCCTCGAGCTGCACTTCGATGACATTCCAGAAAGCGAGCTGGAATTTATTCTGAAAGAACGTTCT
CAGATCGCTCCCTCCTTCTGCACGCGGATTGTTGAAGTTTACCGGAAATTGTCCTTGCTGCGTCAGTCTAATCGA
CTCTTTGAGCAAAAGAACAGTTTTGCCACTCTGCGTGATCTTTTCCGATGGGCTCTTCGTGATGCCGATGATCGC
GAGCAGCTAGCAGTCAACGGTTATATGCTTCTCGGCGAGCGTGTTCGAAATCCCCAAGAGAAAGCCGCCGTCAAA
ACCGTGATCGAGGAAGTGATGAAGGTAAAACTGGACGAGGATACTTTGTATAGCTCTGCAGAGCTGGAAAAGAAT
GCTCCTGAGATGAGCGAGCTTCCAATTGGTATTGTGTGGACTAAAGCCATGAGACGTCTATTCATTCTCGTTTCG
AAGGCCCTCAAGAACAACGAACCAGTCCTTCTTGTCGGAGAAACCGGTTGCGGTAAGACCCAGCTATGCCAGGCC
GTCGCTGAAGCTTTCCGACGCGAGTTGTTCATTGTCAACGCTCATGTCAATTTGGAGACCGGCGACTTGATTGGT
GCTCAACGGCCTATCCGAAACCGGGCTGCTATCGAGAAACAGCTTGTAGATGACCTTCAAATTCTCCTTCACGGG
CAGCTGAGCGGCGCGTCTTTCGATGACTTGAAGCAGGAATTCACAGCATTGACCGCGGAGCAGCGCCAAGCCAAG
GATCAGCTTCTCTTGAAGAAGATTGAGAAGAACGCTATTCGCTGCAATGCCCTGTTTGAATGGTCCGACGGAAGC
CTGATTACCGCCATGAAGACCGGTCAATTCTTCCTTCTTGACGAGATTTCTCTCGCGGATGACTCCGTTCTTGAA
AGACTCAACAGTGTTCTGGAACCTGCTAGGTCGATTCTTCTCGCTGAGAAGGGCCCCGTTGATTCAATGGTTGTG
GCAGATGGTGGATTCCAATTCTTATCCACTATGAACCCCGGAGGTGATTACGGAAAACGTGAGCTTTCGGCTGCT
CTTCGCAACCGCATGACAGAAATCTGGGCACCTCAGCTGTCTGAAGATGAGGACATCTTGCCGATCCTCTCACAG
AGATTGGATCTGAAGGATGAGAGCGTCGCAACGGCTATGCTGCGATTCGCCAAGTGGTTTAAAGTAACCTTCCAG
AACTCCTCTGCCACATCGCTCTCGATTCGTGATCTTCTTGCCTGGGTTGACTTTGTCAATACTTGTCAAAGAGCA
GACACCCCATTTGCTATCGTACAAGGTGCTGCGATGGTCTTCGTCGACACCTTGGGTGCGAACCCTGCCGCAATG
CTTGCCATTTCCCTCAACAATCTTGAGGGCAACCGCAAGTCATGTCTCGACAAGCTGAGCGAACTGTTCAATGTC
GATGCTTCCAAGATCTACTGGGAATCGACCACCGTCTCCGCGGAACCCGGCGTTCTGCGCGTCGGACCATTTGCT
CTACCTACGGCTGGTACAGCAGACCCCGATCCTCAATTCACAATGGATGCCCCAACTACAATCGCCAACTCTGTG
AGAATTGCTCGGGGTTTGCAGTCATCGAAGCCTATCCTTATGGAAGGAAGCCCAGGTGTGGGTAAGACTACACTT
GTGACGGCTCTGGCCAGAGCTCTTGGCAAACCTCTCACTCGAATCAACCTCTCGGAACAGACAGATCTTACAGAC
CTATTCGGTTCAGACGTTCCAGTGGAAGGAGGAGATGTCGGGCAATTCACTTGGCGTGACGCTCCATTCCTACGA
GCCATGCAGCGTGGTGACTGGGTTCTGCTCGATGAAATGAACCTGGCCTCGCAATCTGTCCTTGAAGGTCTCAAC
TCTTGTCTCGATCATCGCCAGCAGGTTTATATCGCTGAGCTGGACCAGACATTCAAGAGACACCCCGATTTCGTT
CTCTTTGCCGCTCAAAACCCTCACCATCAGGGTGGTGGCAGAAAGGGTCTCCCTGCATCTTTTGTCAACCGATTT
ACAGTGGTCTATGCAGACAGCTTCACTGACGATGACTTGAAAACGATTTGTTCCAGACTTTTCCCTGGCAGTCCC
TCTGTGCAGACCGAGAGATTGGTTGATTTCATTTCCCTCTTGAACCAAGCGATCACACGAGATCGTCGGCTGGGA
ACCATCGGTGGGCCATGGGAAGTCAATCTGCGTGATATCCAGCGATGGCTTCAACTTGCCGATCGAGGAAACCTA
CAGATCCAGACAAAGCACTTCCTTAATGTCGTTATCAGCCAGCGATTCAGAAGCGAAGAGGATCGTAACGTGGTC
TCTCAGATTTATGACCGTGTTTTCACAGACTCTGATACTGGCTCGGAGAGCTACTTCCACAACCTCACACCTGAA
TACTTGCAAGTCGGTCTGGGCGTTTTGACCCGTGACCCTCTGCTGCAGCGCTTGGCCGAACCAAACATGAGGATT
CTACCAAATGATCTTCATATTGCCGAGTCGCTCATTTTGTGTATCGATAACTCCTGGCCGAGCATCTTAGTTGGT
CCTGCTGGGTGTGGCAAGACTACTCTCATCAGAAAGCTGGCAGCGGTCAACGGTGCAAACCTTGTCGAGCTAGCT
TTGAGTTCTGATACTGATACTATGGATCTAATTGGTGGATTCGAACAAATCGATCATCGCAGAGAGGTTTCAGGC
TTTGTCCATGATATTGAGATGTTCTTGCGAAACCAGCTCATCCAATGCTTTGCTTCAGGGGATGTATCTGATGTT
GTGATTTCTGCACTCCAAATTTGCGAGCATTTCCAGTCTGCAGATATCTCGCTGGAAAATGTCATCCCCTCGCTT
TCCAGCCTTTGCCAGTCTTCTTCCGACCCTGTCTACCAACAATTCCTCGAGAGAGCCCAAACCTTGTTAAATGCA
ATCCAACAATCCGATAAAATGAAGGTTGGATTTGAATGGACAGAAGGTGTCCTCACTCAGGCTGTTCAACATGGA
AATTGGGTTATTCTTGACAATGCTAACCTGTGCAACCCATCCGTCCTCGATCGACTGAATTCGTTGACGGAACCG
AATGGCACACTCATTCTCAATGAGCAACGGACAGACGATGGATCTGCCAAGGTTATCACGCCCCATGTCAACTTT
AGAATCTTCTTGACAATGGACCCCCGCAATGGCGAGCTGTCTCGTGCCATGAGGAACCGTTGTACCGAAATCTGT
TTCTTGCCAAGTGAGATGCAAGACATCCAACCTACCATAGGCCCATCTTACACCTGTGAATCGTTCCTCTATCGA
CTTCGCCATATTTGGAACTTGGATACCTCCTTGCCATCGTCTGCCTTTGAAGACGCTCTCGAGGTGTGCTTGGAT
CATCTTTCACCAGCGGATCTGGCCTACCTTCAACAGTCACCAAGCAACCGTGTGGCTATCAACTCCGAGCACAAC
GGAGAAGACAAGCCATCCAATGTTCTGCAGCGCTATACCTCTCTGTTCCATGACAACAACCAATGGAAGCCGCTT
GACATCGCCAGCGGCGAGATTGTGCTTGGTGGGGCCCACCTTGGTATCCGAGGAATGTTGCAGCCTCTTCACCCG
CTTACAAATGAGCCTCTGATAGCTATTGCAGGAACCAGTGATTTCCGGTCTAGTTTGATTGTCTTGGCTTATCTT
CAGGAGCTGAGACTTGATATTCATCGCCTCAGGGAAGGTTTGATTCAAGCCGACGTATCCGGAAAAGAGCTCAAG
CCTAGCCAAATGACACGTTTGGAGCGGTCATTGGCATCTGAGCGGATCCCTGCGTTGATGAAAGACACAACGCAA
CCTGTTGCCTCGTTCTTGTCTGATTGTGGCCAGGCTCTGTATGATTACATTCAGTCGTTGGATCAAATCTCTCTC
CAAGGCCCTGTAATAATCGCAGCCCTTCGGACCGTTATCTGTCTATGCTGGGACATTTACAGAGCCACAGAGGTT
AGTCAGGTTGATGAAGGAGAATTCCAAGTCTACCTTCAGATGGGCCGAAAGATCTGCGGGTCGTTGCTCGACTCG
TCCCCTCTTCTCAACCCGCTCCAAGTCGCTTTATCACAGGCCCTGGATCGATTCCAGGAAGGGTGGGCTTTGACG
ACTGGTCTTAGCATGCAAAGAATCTGGGATTCTTGGAGACATGTCACTCCTATCTCTCAAGATAAGTTGAATTCT
CTAACCGAGTTGGAGTCAACAGTCTTTGATTTCACAACTTTGGCTTTGCAAACCCGTGTGGAATTGTCTCAATTG
AGTCGTGTGCGCAACTCATTGATTGATGCCCAGCGATTCATTCTTCTGGATGGTGCTGATGGTGACGTACTTGTT
CAGGGTATCAAACAAACCGTCGCTGAGCTATCTCATGCAGTTCGACGTTCAGAGTCAACCGAGTATCCATACTTT
GCAAACGATTTCGAAGCTCTTTGCCAGTACCACGACATCTCCTCATTTTTCCAGAACCCAGTCCACGATACTGTC
ATCCAGACAGTCCTGCCACTCCTCGCTGGTCGTGCGGCTCGTCCATTAGACACGTCGAATTTCCAAAGCGACGTG
CCAAATATTCTCCATAGAATCTCGCTATTTGCGGGTTCTTCAAGCAAATCCGAGTCTGCGCTTGCTACTGGTGGT
ATTATTTCTCTGTCGCTATTGGATAAGCTGGCAACTATCGGCAATACAAAATTGGGGCAGATGGACATGCTTGAG
GCAGAGAAACAGGCTCTCTCCAAGGCTATTTCCTTGAGCAGTCAACAGATCACAACAGACCAGTCCATGGTCCTT
GGACGTACTATCGCTAAGCTCACAGCCGAGCTGGTGGCTTGTCATCGGGAGTTCTTCGAGCCTCGCTCAGCCGAG
GATCTCATCTCTGTTCTGCAAGCGATCCAAAATGGGGATCTTTGCGTTGAACAGTCACCTATCAAGGTTGAACTA
GACCAAAGCTTGCCAAATGCTCTCTTCTTTAGGCCCCTCGCCGAACAGGCTCTACCGGCTCTGATTTCGTCCCTC
CAAGCATCAAGCCAGCAGCAGAGCATTCGAACCACTGGACTGGCAGCAGTACAGCTAGCAGTCATTCTTCTGCGT
CTATTCGTCCCCGACAAGACATTTGACCCTTCTCTCGGTCTCGTTGTTCAACGCAAACGCCACTCTCAACGTCTG
CAAGAATACACGGCCAAGTCTGCAGCAATTCTTGCCTTTGAGAAGTCTTTCACCAACCAGGTTTCCAACCTCCGG
TCTGAACTTCTGCACAATGAAATCCGTGATCTAGGTTCTGCCCCCCCTCCTTCACTGGTAAACCGGCCCCAGCAG
TCCCAGTTGAGTCTCTTGCAGGGAGAGTTCGTCAATTTAATCAACACTGTCCTGAAGAGAGACCCGGAGCAAATG
GTCCGCTCTGCCGAATCTTCGCAGTCCCAAGACATGATCCAGCTTCTGCGTAATAACATCAAACAATTGAGCAGT
CGTCTTAGCACTCACTACAGATCCTATGACGATATAACCGTGCCCGTGGTTCGTTTCTTGCAGCTTTTGGACCTT
GGTGTGTTCTTGGCGTCTAGCCAGCCGGAACAGTCTGGCGATATTCCTGATATTCAGTCTCTGAGCGCGCGAACA
CCCTTTTTAGGAGGTATCCACCACCCCGTTCTTGCTCAGGATGATCGGAAGGCCCCTGGCACCCTGAAGAATGCA
AACGAAATGCGCCTTCAAGAACTGTCGGCCCTTTGGGCCGCCAAGGATGCGGATTCCACAATCTTGAATACAAAG
GCTGGACGAGATATTATTCGCCGTGTTTTCGCTGATTTCCATCAACTATGGAAGACTAAGCTCGAAGAAGATCGG
GAGCTAGAAGCCGAAAAGGGAGAATTGTACCGCTTCAAGGGATCCTGGGAAGAGGAAGAAGAAGTCAACGAAGCC
GAGCTACATGCACTTTTCCCTACATTCGATGAAGGATCAGCTGAAGACACAGAAACGACGGATGCTGCTGACCGT
ATTGACCCCAAGAGCATCGCTCTCCGGCTTGCCTCGCTTCATGCAAATATCGTCTCGAATGAGCGCAGTGGAACT
GCATTGACTACCCTTGTCAAGCAATCAGGGCATCTTTTGGGCTCAATCTGGTCTGAAAACAAGACATCATTCTCG
CCTATGTCACCCCAGAACCATCTTCCTGCAGTTCTTCTACTTCTCGATGATGCCATAGGCGAGGGAACCAACAAT
CACCAAAAGAATTACAACTTCTACACCGATTCGAATCTCGAAGAGGCAAGGAAGCTGGTTGCTCTCGCGCTTTCT
GTTCAAGCCCGCTTTGCCCAGATCCAAACTGCCTGGCCTGAACATGTTGTCCTCGCTGATGTCATTCAATGCTGC
GTGCAAATCCTTCAATTCAAGCACACTGAACCTGTTGCCAAGTTCATGACCAAGGTTGAAAAGCTTCATTCATTC
GTACATGAGTGGCAGACCGTGGCCAGCAGAGAATATTCAGCTGTTACCGTCTACGACGAGATTACATCTATTCTC
ATTAGCTGGCGCCGTCTTGAGCTGTCAACTTGGGCTAAGCTCTTAGATATCGAGAAAGAGCGATGCGAGGACGAG
GTAAGTGCTTGGTGGTTCATCGCCTATGAAGTACTCATCGGCGCTCCCATCATGATGGTCGAGGCAGGCGAACAA
GACATGACCGAACACACCCAAAACTTGGTCTTGACTCTAGAGCAATTCTTCAATTCTACAACTACAGGGCAGTTT
GCTCGCCGTCTACAGCTTGTTGCAAACTTCCAAGCATTGCTTGAAGTTTTCACCACAGATTATCCCTGCCTCAAG
AAGCTTGTCTCTGCCTTGGACAACTTCCTCCACCACTACGGACCCTTCCAGCCTGGGGTGGACAAGTATCTGACG
GAGAAGCGGTCGGTTCTTGAGAAGGATATCAAGGAGCAAATTCAGCTTGCGAGCTGGAAAGATGTCAACATTGTG
GCTTTGAAGGAAAGCGCCAGAAGGTCGCATGTGAAACTATTCAAGTTGGTTCGAAAGTACCGTGCAGCCCTTGGC
CAGCCAGTTCAATCAATCCTTGAAGCAGGCCTTCCGGAAAGCACGGAGGAGATCACTTCCATGTCACAAGCAGAG
CCGGTTCGCCCCACTGCCACGTTCCCCGAGGCAATGGCCATTTGTCAAAATGATAAAAAGCTGTGGTCCACTCGA
GCGCTCAGATTTCAGAAGCCGGATGGAACAGCCAACAACATGATGAATTTGTATTCTTCAATTCCAGCCGAGTTC
GACATTGCGAAGGATCTCGACAGCTTCATTGTCTCCGTGATTGAAAGTATGAATGAGTTCAAGTCCAAGACACCC
AAGGTCCTGAACGAAGACAACAAGGACGACGTCCAGCACCTCAAATCCCAGAAACGCCGTCTCTATGCCGAGACC
CTCAAACAACTATATGAGATGGGTGTGAAACGTAATGCTGGATCGAGTGTGATTGAAACCCAAGAAACAGTTCCT
CAAGTTCTCGCCACTAGTGCCGCCTTTGAGGCTGGCGCTGCAACCTCAACTGCAGTTCAGAGTGCCGACTGGTAC
TTCCACAGACTTCTGGATCTCCTGCCTAAGACCCGCCTAGCGTCTCGCAACTATTCCGAGGAGCTAAGCAACGTC
GAAGTCCACCGAAGCATGGGGTCTATTGAGCATCTCATTCTCACCGTCCGCCGCCAGAGAGGTGTCATTTCGCCT
GCCCTCACAGGCTTGGGCAAGCTGAAGTCTACGCTTGACAAGGTGCAGAACCTTTGGGCAGCGACTTCAAACTAT
CTGTCGCAAGACCATGCTTCTGCATCGGAGAAGCGAACCAATCTAGCTAGAATCGTGGCTTGGCTAGCGCCTATT
CTTGGACTTGCCGCAATGATTATTGGAGTGCATTCCAAGTTCTCGGGAATTGACGCATCTAAGATTGTGGAACAG
CTCCGCGCCAAAAAGGCATCCTTCGATAGCCTACGCAAGTCGCATGAAGCTCTTCCCATGCTTCCTACGAGGATT
GCGTCTAACGCAAACCACGAGATCGCGCAGCAGGCACAATCGTCGCTCGATGAATTGGCGGCTGACTTGAAGCAA
TGGAGTCAAGCTCGCCCTGATCTGTCCTTCGCGCTGGATCAGATTACACCTTGGGTCAAGACAAAGGTTGCTGAT
GTCCCTGAGGTTAATGATGAGAACAGCCTATCCATCCAAGCCTTCGATAGCAGCCTCCTGACGGCCATTGACAAA
ATGCTCATCGGCCTGCAGAAGCTCAAGGATGTGCCTTCTGCCATCACCTTTGATGGATTGCTGTCGAGGAGTGAT
GAGTTCTTCTCTCGCGGTATTAAGGCTGTCCATCTCCCAGAGATCACCGCCGCATTGGAGAAGGTCCTTGACCAA
TTGCACCTCCTGCAAGATCACTCCGCTGGCGGTCTCTCCGTTGCTGCCGCACTGCTCACCAGTATCTTGCCTATC
GCCAACAGATACTACCAAATCTGCCGGGATCTGGCTGATCGGTTCATCGCCGTTCACCGCGAGATCTGTAAGACA
TCCTACATCCTGACCAAGACTTTCAAGCAGGTCGCCTCCGAAGGCTTCTGTAGTCCTGCCGAAGCCTCCCAAGAT
CAAGGCAAGGAAGGCCAGATGGAAAGTGGAACTGGTCTCGGTGAAGGAGAAGGAGCGGAGGATATCAGCAAAGAT
GTTGGTGATGACGAAGATCTATCTGAGTTGGCGCAACAAGAGAACAAGAAAGAGGACGGTGATGATGAGATGGAT
GATTCCAAGGATGCTGTCAACATGGATCAGGAAGAGTTGGAAGGTGATGCCGAGGATCGCAAGGACGAGGAGGAG
GAGAACGACGACAGTGCCGAGGAAGGAGATGACGATATCGACGAAGAGACGGGAAGCGTTGATGACCTTGACCCT
GGTGCTGTGGATGAAAAGCTCTGGGACGGTGGTAATGATGAGCAGCAGAAGGATACTGAGAATGAAGAAGGAAAG
GGCCAATCGGAGGCCGAGCAACAAGCTGCTGCTCAGGAAGAGAAGGGCGACAAGGATGAAAATGGTGAAGAAAAG
CAAAAGGAAGGAGAGGAAGAGGAAGAGGAAGAAACAGAAGATGAAGAGGCCCCCGAAGACGAGGGTGAGGCAGTT
GGACGTGAAGAAATGGACGTCACCGACCCTCAAGCAAAGGAAGAAGAAACACTTGAACTTCCCGAGGAAATGCAA
CTTGATGATGGTGAAGGCAAGGATGACAATGGCGAGGACGACGATGACATGGATGACCTTGACGACGATTTCGGT
CCCGCCCCCGAAGAAGAAGCAGAAGGGAAGGACGAAGATGTCAATGATGAAGCCGGCGAAGAAGATGCCGAGGCA
GCAGAAGATCAAGTGCCAGGTGAGGAAGATGAAGAAATGGCCGATGATGCGGAGGAAACCAACGAAGGCGAAGCC
GGAGAAGAGGAGGAAGAGGAAGCTGGTGGCGAAGATCCCGAGGAGTCTGAGCAAGACGACTTCCTCGCACAGCGT
GATGAGAATGATGCCGCAGGTGACAACGTCGCTCCTAGTGAAGCTGTTACTGGCGGGCTCGGAGCCGAGCAAGAC
CAAAATGAAGAAAAGGGTGCATCGGGTGACGCTCAGCAGGAGAGCGGCTCGACTGATCCCAGTGCCAATGTCGAC
CAACAGACAGGCGCTGCTAAGGATAGCGAGGAGAGCCAGCCCAGCCGAGACGCTGCTGGCGGCGAAGATCACGGG
CCAGATGAACCTCAGATGCAGGCATTCAAGAAGCTCGGTGATATCCTCGAGCAATGGCACCGACGACAAAAGGAG
ATTCTCAATCCATCTCAACAGGAAGAGGAATCCCAAGCTATGCCCCAAGACACTGATATGGCCGACGCGGACTTT
GAGCACCTAAAGGATGACGATGATGCCGCAGACACCCAGGCCCTTGGACAAGCAAACGACGACCAAACGCAAGCC
CTCGACCAAAGCAAGGGTGTGGAGTCCGACATCAAGCCTGGCGAGAACGATGTTCTCCCAGACGTGTCGGACGAG
CAGCAAGATGCCGTGGACAACCAGCTTGAGGATGAGATGGAAATCGACCGCGAGAATGTTCCCACAGATGGCGAG
TCCGTTGGCGCCTTCATTCCTAGCGGTCAATCATCCCACGATCGCGCAGACGGAGCACAAGGCACCGAAGAAGTG
GACGAGGAACTGGACGAAGTTGACTCGCAACTCGCAGCAATCCATCTCTCCTCTTCGCTTCCCCCATTGACTCCA
CAAGACGAAGCCCGCCGCCTCTGGTCGCACTATGAGTCTGCCACAAACGACCTCTCCCTCTCCCTGACCGAACAA
CTCCGTCTCATTCTCGCCCCCACAATGGCCACCAAGCTCCGCGGTGACTTCCGCACTGGAAAGCGGCTGAACATC
AAGCGTATCATTCCCTACATCGCATCCCAGTACAAGCGCGACAAGATCTGGATGCGCCGCTCTATCCCCTCAAAG
CGTAACTACCAGATCATGCTGGCCGTCGACGACAGCAAGTCTATGCTGGAAAGTGGCAGTGGTCAGCTCGCCTTT
GAGACCCTCGCCCTCGTTGCCAAGAGTCTGAGCATGCTGGAAGCTGGTGACTTGTGTGTTCTCGGCTTCGGTGAC
GAAGAGCACGTTCGTGTCGCCCACGAATTCGGAAAGCCTTTCTCCTCCGAGGCAGGCTCCCAGGTCTTCCAGCAC
TTCAGCTACCAGCAAACTGGTACCAATGTGCGCAAGCTGATTGCCGACTCTATCGCTCTCTTCCGCGAGGCTCGC
TGGAAGCGCTCGCCTGGTTCCGGCTCTGCCGATCTCTGGCAGCTTCAGTTGATTATCTCTGATGGTATCTGTGAA
GACCATGATACCATTCGCCGTCTTGTCAGGCAGGCGCTTGAGGAGCGCATCATGGTTGTCTTTATTATCGTCGAT
GCTGTCAAGGGTAGCTCCATCCTTGACCTCTCGCAGGCTAGCTTTGAGGCCGATCCTGGCTCTGGTGGTGAGATG
AAGCTCAAGATGAAGCGATACCTCGAGGACTTCCCCTTCCCTTACTACCTTGTCGTTCGTGATGTGAAGGAGTTG
CCCTCTGTTCTGGCCACTGCACTCAAGCAGTGGTTCGCCGAAGTTGTGGATGTGTCGTCTTGA
Transcript >Pro_DTO377G3_2|g9665.t1
ATGGATCGGAGGCCGGTCTATGAGAGGACTCTTACTGAGTCCGAACTTCTCGAGCAGCTTCCGAGTGGAATCTCG
ACTTTCATTCGGACTGCATCGGGGACGCAACACCTCCACGCTCTTGCGCTTGGCGCATTAAACAACGAATTTACA
GAGAGCATTTTCAGACTATACGAACCGATTTTCGTCGATCTTGCAGCTAGATGGCTTCAATCGGATTTACATGCC
GACTACATTCATGTATTAGCGGCATTCGCGCAGATTTTACCATTTGCGCCGCACCTGCGCTCGCTTGCCAGTCAA
TATGCCTCATCACAGACTGGACCTTTGGTGGCTTTGGCCGTGTCGAAGGAATTAACACTGCTACAATTGGATCAA
GTTAGCATTAGACTTCTACTCCTCGCCCTCTTCCGACTTCTTTCATTTGATCTTGAAACCTTCTCTCCCATCATT
TCACCGCTTCAACTGCAGTCCCTCTTCCAATCCCAAGATCGAGTAACACGATACCTTGCTGTACGATGCTTTGCC
TTATATATGCACGCAGCCGATGCGGCAACCGAAAAGATGGTCCGCGTCAATACCGGGACTGAGCCTATAGAAGGA
GAGTGGGAAGGCACTCTGATCGATTACCGTGTGCTAGGATTGTGGGAAGAACGCCGATGGGAGACTCTTGGGGGA
ATTATTCGGGCCGAGAGGACTTCCAGGACGGAAAACAACACCCTGGCGTTGATCGAGAGGACACGGGACTCTTTC
ACAACCAAGACCGCAGAAATCTGCGGTGTTTTGATTCCCAGGTTGAAAGATACACCCGCGGCTCCTTCGTCTGTC
GTCAAGACTACTACCACAGTTGAAAATCTGCGCCGAATTGCAGGGTCATTACTCGGTTACAAACCCATCCTGCTG
GTCGGTTTGCCCAACTCCGGGAAGACCTCTTTGATTAATGATATTGCTGCCACGATGGGCCAGATTGAAACTATG
GTCACACTTCACTTGAACGAACAGACAGATGCGAAGAGTCTGCTTGGAATGTATGCCACTTCATCTGCCTCCGGA
TCATTTTCTTGGCAGCCTGGTGTATTGACCAAGGCTGCACGCGAAGGTCGCTGGGTGTTGATTGAAGACCTTGAT
CGTGCTCCATCTGAAGTAATGGGCCTCATTCTCCCGATCATTGAGAGGGGCGAGCTCACTATCCCGAGCAGGAGG
GAGCGAATCAAGTGTGCCGAGGGCTTCAAAATCATCGCAACCATGAAGTCATCGTACAACATTGCCGGCGAGGAG
ATCGCACCGAGCAATTCAATGCTCGGAAGCAGACTCTGGGAGAGAGTGCAAGTCAAGTCTCTTCCCGTGGATGAG
ATGCGTGATGTCATCCTGCAAAAGTTCTCTTTGCTTGAGTCTCGTGTGCCAACTCTCATGAACGTCTACGGACGA
GTATGCTCTGCATTCCATGGAAGTCTTGCGATCAAGGGCTCTCAAGGCCGTACCCCGGGCTTCCGCGATTTGATC
AAGTTGTGCAACCGTCTGCACAATCGCCTACACCGCATAGGTGCGAAGACTGGCTATGAGCCCACGTCAGAAGGT
ACCGAGGATGAAATATTCCTCGACATTGTTGACGTGTTCCTCCGGTATCTGCCCGAGAAGTCAATGCAAAGCACT
CTCGCCGCCGTTGTGGCCGAAGCGCTTCAAATTTCTCCCCAGCGAGCGCAATATTGTCTCAATGAACGCACCCCC
TCTTATATCGACAAGAACAACAGCCTTGTTCTTGGCAGAGAAACCTGTAACAAGATCAAAGTACCAAGTGGATCT
GCATTGAAGCTTGCCGCAGCAGCTTCACGATTTGCCCCCACCCGAGCGGCATTAACCCTCATGGAACAGGTAGCT
GCCTCAATCCAGATGGCAGAGCCTGTTTTACTTGTTGGAGAAACTGGTATCGGAAAGACCACGGTCATCCAGCAT
CTTGCATCTTTGATGCGTCAGAAACTCACAGTAGTAAATTTGTCACAACAGAGTGAAAGCACTGATCTGCTGGGT
GGTTTCAAACCCGTCAACATCCGTACAATGGCAGTTCCAATGCTCGATGAATTCACTCAGCTCTTTGAACTGACT
TTCTCGGCCAAAAAGAACCAGAAGTTCTTGTCGTCCATATCGAAGAGTGCCGCGTCTTCCAATTGGGTACGATTG
GTGACCTTGTGGCACGAAGCCGTTCGTCTTGCAAATGGAGTGTTCAATCCCTCGAATGCCACAGGGGAGAATGGC
GATGAACAGCCAGCCAAAAAACGGAAGCTGGATTCTCCCAAATACCAGCACTTGCGGCAAAGATGGGAGAGCTTC
GCAACACAGCTCGGAGATTTCGAGGCTCAGGTCTCACAAGGTGATGCCAAATTTGCCTTTGCCTTTGTCCAAGGT
AAGATTGTGAGAGCCCTACGAAACGGCGAATGGGTCCTCCTGGATGAAGTGAACTTGGCTTCCCCTGATACCCTT
GAGAATATTGCCAGTCTTCTGCACCACGGAAGTGAGGGAACGCCATCTGTTCTCCTCTCCGAGGCTGGCGATGTT
GAGAGAGTCTTCGGCCACCCGGAATTCCGTATCTTCGGTGCTATGAACCCTGCAACAGATGCTGGAAAGAGAGAC
CTTCCCCCCGGTTTGCGTTCTCGGTTCACCGAATTCTACGTACACTCACCCGATAGCGACTTGGATGATTTATTG
GCTTTGATCCAGAAATACCTTGGTGATTTGACAATCAGTGACCAGCGTGCCGTGCCAGACCTCGCACAGCTTTAC
ATGGTGACCAAGAAGCTCAGCAACGAGAACAAGCTTACTGATGGAGCTGGACAGCGACCTCATTTCAGTATCCGT
ACTCTTGTGCGGGCCTTGATCTATGTCATCGACCACGCACATGTCTACGGGCTACGCAGGGCAATGTTTGAGGGT
TTTAGTATGAGTTTCTTGACCGTGCTGAGCTTGGTCTCCGAACGGGCTTTGATACCTCTACTTGAGCTTCATATC
TTTGGGAACGCGAAGAACGCCAAGTCTCTTCTCGGACAGACCCCCCGCCCACCAACTGATGGCAATGATTATGTG
CAATTCAAACATTACTGGATGCGCCGCGGTCCTATGCTCCCGGAGGAGCAGCCACACTACATTATCACCCCATTC
ATTGAGAAGAATCTGAAGAACTTAGTCCGGGCTAGTTCAACTCGGCGATTCCCCGTTCTGCTCCAGGGTCCGACA
TCAGCCGGAAAGACGAGTATGATCGAGTATCTGGCAAAGGTGTCTGGAAACAAATTTGTACGAATTAACAATCAC
GAGCATACAGATCTGCAAGAGTACCTAGGGTCTTACATCTCGTCAGACGATGGAAGCCTGCGTTATCAAGAGGGT
GTGTTGGTGGAGGCGCTGCGGAACGGTTATTGGATTGTGCTGGATGAGCTGAATCTAGCGCCTTCTGATGTTCTT
GAAGCCCTTAACCGACTCCTCGATGATAATCGTGAGCTTTTCATTCCCGAAACTCAAGAAGTTGTCCACCCGCAT
CCGAACTTCATGCTGTTTGCCACGCAAAATCCCGCTGGTCTGTACGGTGGCCGAAAGGTCCTATCCCGTGCCTTC
AGGAACCGTTTCCTCGAGCTGCACTTCGATGACATTCCAGAAAGCGAGCTGGAATTTATTCTGAAAGAACGTTCT
CAGATCGCTCCCTCCTTCTGCACGCGGATTGTTGAAGTTTACCGGAAATTGTCCTTGCTGCGTCAGTCTAATCGA
CTCTTTGAGCAAAAGAACAGTTTTGCCACTCTGCGTGATCTTTTCCGATGGGCTCTTCGTGATGCCGATGATCGC
GAGCAGCTAGCAGTCAACGGTTATATGCTTCTCGGCGAGCGTGTTCGAAATCCCCAAGAGAAAGCCGCCGTCAAA
ACCGTGATCGAGGAAGTGATGAAGGTAAAACTGGACGAGGATACTTTGTATAGCTCTGCAGAGCTGGAAAAGAAT
GCTCCTGAGATGAGCGAGCTTCCAATTGGTATTGTGTGGACTAAAGCCATGAGACGTCTATTCATTCTCGTTTCG
AAGGCCCTCAAGAACAACGAACCAGTCCTTCTTGTCGGAGAAACCGGTTGCGGTAAGACCCAGCTATGCCAGGCC
GTCGCTGAAGCTTTCCGACGCGAGTTGTTCATTGTCAACGCTCATGTCAATTTGGAGACCGGCGACTTGATTGGT
GCTCAACGGCCTATCCGAAACCGGGCTGCTATCGAGAAACAGCTTGTAGATGACCTTCAAATTCTCCTTCACGGG
CAGCTGAGCGGCGCGTCTTTCGATGACTTGAAGCAGGAATTCACAGCATTGACCGCGGAGCAGCGCCAAGCCAAG
GATCAGCTTCTCTTGAAGAAGATTGAGAAGAACGCTATTCGCTGCAATGCCCTGTTTGAATGGTCCGACGGAAGC
CTGATTACCGCCATGAAGACCGGTCAATTCTTCCTTCTTGACGAGATTTCTCTCGCGGATGACTCCGTTCTTGAA
AGACTCAACAGTGTTCTGGAACCTGCTAGGTCGATTCTTCTCGCTGAGAAGGGCCCCGTTGATTCAATGGTTGTG
GCAGATGGTGGATTCCAATTCTTATCCACTATGAACCCCGGAGGTGATTACGGAAAACGTGAGCTTTCGGCTGCT
CTTCGCAACCGCATGACAGAAATCTGGGCACCTCAGCTGTCTGAAGATGAGGACATCTTGCCGATCCTCTCACAG
AGATTGGATCTGAAGGATGAGAGCGTCGCAACGGCTATGCTGCGATTCGCCAAGTGGTTTAAAGTAACCTTCCAG
AACTCCTCTGCCACATCGCTCTCGATTCGTGATCTTCTTGCCTGGGTTGACTTTGTCAATACTTGTCAAAGAGCA
GACACCCCATTTGCTATCGTACAAGGTGCTGCGATGGTCTTCGTCGACACCTTGGGTGCGAACCCTGCCGCAATG
CTTGCCATTTCCCTCAACAATCTTGAGGGCAACCGCAAGTCATGTCTCGACAAGCTGAGCGAACTGTTCAATGTC
GATGCTTCCAAGATCTACTGGGAATCGACCACCGTCTCCGCGGAACCCGGCGTTCTGCGCGTCGGACCATTTGCT
CTACCTACGGCTGGTACAGCAGACCCCGATCCTCAATTCACAATGGATGCCCCAACTACAATCGCCAACTCTGTG
AGAATTGCTCGGGGTTTGCAGTCATCGAAGCCTATCCTTATGGAAGGAAGCCCAGGTGTGGGTAAGACTACACTT
GTGACGGCTCTGGCCAGAGCTCTTGGCAAACCTCTCACTCGAATCAACCTCTCGGAACAGACAGATCTTACAGAC
CTATTCGGTTCAGACGTTCCAGTGGAAGGAGGAGATGTCGGGCAATTCACTTGGCGTGACGCTCCATTCCTACGA
GCCATGCAGCGTGGTGACTGGGTTCTGCTCGATGAAATGAACCTGGCCTCGCAATCTGTCCTTGAAGGTCTCAAC
TCTTGTCTCGATCATCGCCAGCAGGTTTATATCGCTGAGCTGGACCAGACATTCAAGAGACACCCCGATTTCGTT
CTCTTTGCCGCTCAAAACCCTCACCATCAGGGTGGTGGCAGAAAGGGTCTCCCTGCATCTTTTGTCAACCGATTT
ACAGTGGTCTATGCAGACAGCTTCACTGACGATGACTTGAAAACGATTTGTTCCAGACTTTTCCCTGGCAGTCCC
TCTGTGCAGACCGAGAGATTGGTTGATTTCATTTCCCTCTTGAACCAAGCGATCACACGAGATCGTCGGCTGGGA
ACCATCGGTGGGCCATGGGAAGTCAATCTGCGTGATATCCAGCGATGGCTTCAACTTGCCGATCGAGGAAACCTA
CAGATCCAGACAAAGCACTTCCTTAATGTCGTTATCAGCCAGCGATTCAGAAGCGAAGAGGATCGTAACGTGGTC
TCTCAGATTTATGACCGTGTTTTCACAGACTCTGATACTGGCTCGGAGAGCTACTTCCACAACCTCACACCTGAA
TACTTGCAAGTCGGTCTGGGCGTTTTGACCCGTGACCCTCTGCTGCAGCGCTTGGCCGAACCAAACATGAGGATT
CTACCAAATGATCTTCATATTGCCGAGTCGCTCATTTTGTGTATCGATAACTCCTGGCCGAGCATCTTAGTTGGT
CCTGCTGGGTGTGGCAAGACTACTCTCATCAGAAAGCTGGCAGCGGTCAACGGTGCAAACCTTGTCGAGCTAGCT
TTGAGTTCTGATACTGATACTATGGATCTAATTGGTGGATTCGAACAAATCGATCATCGCAGAGAGGTTTCAGGC
TTTGTCCATGATATTGAGATGTTCTTGCGAAACCAGCTCATCCAATGCTTTGCTTCAGGGGATGTATCTGATGTT
GTGATTTCTGCACTCCAAATTTGCGAGCATTTCCAGTCTGCAGATATCTCGCTGGAAAATGTCATCCCCTCGCTT
TCCAGCCTTTGCCAGTCTTCTTCCGACCCTGTCTACCAACAATTCCTCGAGAGAGCCCAAACCTTGTTAAATGCA
ATCCAACAATCCGATAAAATGAAGGTTGGATTTGAATGGACAGAAGGTGTCCTCACTCAGGCTGTTCAACATGGA
AATTGGGTTATTCTTGACAATGCTAACCTGTGCAACCCATCCGTCCTCGATCGACTGAATTCGTTGACGGAACCG
AATGGCACACTCATTCTCAATGAGCAACGGACAGACGATGGATCTGCCAAGGTTATCACGCCCCATGTCAACTTT
AGAATCTTCTTGACAATGGACCCCCGCAATGGCGAGCTGTCTCGTGCCATGAGGAACCGTTGTACCGAAATCTGT
TTCTTGCCAAGTGAGATGCAAGACATCCAACCTACCATAGGCCCATCTTACACCTGTGAATCGTTCCTCTATCGA
CTTCGCCATATTTGGAACTTGGATACCTCCTTGCCATCGTCTGCCTTTGAAGACGCTCTCGAGGTGTGCTTGGAT
CATCTTTCACCAGCGGATCTGGCCTACCTTCAACAGTCACCAAGCAACCGTGTGGCTATCAACTCCGAGCACAAC
GGAGAAGACAAGCCATCCAATGTTCTGCAGCGCTATACCTCTCTGTTCCATGACAACAACCAATGGAAGCCGCTT
GACATCGCCAGCGGCGAGATTGTGCTTGGTGGGGCCCACCTTGGTATCCGAGGAATGTTGCAGCCTCTTCACCCG
CTTACAAATGAGCCTCTGATAGCTATTGCAGGAACCAGTGATTTCCGGTCTAGTTTGATTGTCTTGGCTTATCTT
CAGGAGCTGAGACTTGATATTCATCGCCTCAGGGAAGGTTTGATTCAAGCCGACGTATCCGGAAAAGAGCTCAAG
CCTAGCCAAATGACACGTTTGGAGCGGTCATTGGCATCTGAGCGGATCCCTGCGTTGATGAAAGACACAACGCAA
CCTGTTGCCTCGTTCTTGTCTGATTGTGGCCAGGCTCTGTATGATTACATTCAGTCGTTGGATCAAATCTCTCTC
CAAGGCCCTGTAATAATCGCAGCCCTTCGGACCGTTATCTGTCTATGCTGGGACATTTACAGAGCCACAGAGGTT
AGTCAGGTTGATGAAGGAGAATTCCAAGTCTACCTTCAGATGGGCCGAAAGATCTGCGGGTCGTTGCTCGACTCG
TCCCCTCTTCTCAACCCGCTCCAAGTCGCTTTATCACAGGCCCTGGATCGATTCCAGGAAGGGTGGGCTTTGACG
ACTGGTCTTAGCATGCAAAGAATCTGGGATTCTTGGAGACATGTCACTCCTATCTCTCAAGATAAGTTGAATTCT
CTAACCGAGTTGGAGTCAACAGTCTTTGATTTCACAACTTTGGCTTTGCAAACCCGTGTGGAATTGTCTCAATTG
AGTCGTGTGCGCAACTCATTGATTGATGCCCAGCGATTCATTCTTCTGGATGGTGCTGATGGTGACGTACTTGTT
CAGGGTATCAAACAAACCGTCGCTGAGCTATCTCATGCAGTTCGACGTTCAGAGTCAACCGAGTATCCATACTTT
GCAAACGATTTCGAAGCTCTTTGCCAGTACCACGACATCTCCTCATTTTTCCAGAACCCAGTCCACGATACTGTC
ATCCAGACAGTCCTGCCACTCCTCGCTGGTCGTGCGGCTCGTCCATTAGACACGTCGAATTTCCAAAGCGACGTG
CCAAATATTCTCCATAGAATCTCGCTATTTGCGGGTTCTTCAAGCAAATCCGAGTCTGCGCTTGCTACTGGTGGT
ATTATTTCTCTGTCGCTATTGGATAAGCTGGCAACTATCGGCAATACAAAATTGGGGCAGATGGACATGCTTGAG
GCAGAGAAACAGGCTCTCTCCAAGGCTATTTCCTTGAGCAGTCAACAGATCACAACAGACCAGTCCATGGTCCTT
GGACGTACTATCGCTAAGCTCACAGCCGAGCTGGTGGCTTGTCATCGGGAGTTCTTCGAGCCTCGCTCAGCCGAG
GATCTCATCTCTGTTCTGCAAGCGATCCAAAATGGGGATCTTTGCGTTGAACAGTCACCTATCAAGGTTGAACTA
GACCAAAGCTTGCCAAATGCTCTCTTCTTTAGGCCCCTCGCCGAACAGGCTCTACCGGCTCTGATTTCGTCCCTC
CAAGCATCAAGCCAGCAGCAGAGCATTCGAACCACTGGACTGGCAGCAGTACAGCTAGCAGTCATTCTTCTGCGT
CTATTCGTCCCCGACAAGACATTTGACCCTTCTCTCGGTCTCGTTGTTCAACGCAAACGCCACTCTCAACGTCTG
CAAGAATACACGGCCAAGTCTGCAGCAATTCTTGCCTTTGAGAAGTCTTTCACCAACCAGGTTTCCAACCTCCGG
TCTGAACTTCTGCACAATGAAATCCGTGATCTAGGTTCTGCCCCCCCTCCTTCACTGGTAAACCGGCCCCAGCAG
TCCCAGTTGAGTCTCTTGCAGGGAGAGTTCGTCAATTTAATCAACACTGTCCTGAAGAGAGACCCGGAGCAAATG
GTCCGCTCTGCCGAATCTTCGCAGTCCCAAGACATGATCCAGCTTCTGCGTAATAACATCAAACAATTGAGCAGT
CGTCTTAGCACTCACTACAGATCCTATGACGATATAACCGTGCCCGTGGTTCGTTTCTTGCAGCTTTTGGACCTT
GGTGTGTTCTTGGCGTCTAGCCAGCCGGAACAGTCTGGCGATATTCCTGATATTCAGTCTCTGAGCGCGCGAACA
CCCTTTTTAGGAGGTATCCACCACCCCGTTCTTGCTCAGGATGATCGGAAGGCCCCTGGCACCCTGAAGAATGCA
AACGAAATGCGCCTTCAAGAACTGTCGGCCCTTTGGGCCGCCAAGGATGCGGATTCCACAATCTTGAATACAAAG
GCTGGACGAGATATTATTCGCCGTGTTTTCGCTGATTTCCATCAACTATGGAAGACTAAGCTCGAAGAAGATCGG
GAGCTAGAAGCCGAAAAGGGAGAATTGTACCGCTTCAAGGGATCCTGGGAAGAGGAAGAAGAAGTCAACGAAGCC
GAGCTACATGCACTTTTCCCTACATTCGATGAAGGATCAGCTGAAGACACAGAAACGACGGATGCTGCTGACCGT
ATTGACCCCAAGAGCATCGCTCTCCGGCTTGCCTCGCTTCATGCAAATATCGTCTCGAATGAGCGCAGTGGAACT
GCATTGACTACCCTTGTCAAGCAATCAGGGCATCTTTTGGGCTCAATCTGGTCTGAAAACAAGACATCATTCTCG
CCTATGTCACCCCAGAACCATCTTCCTGCAGTTCTTCTACTTCTCGATGATGCCATAGGCGAGGGAACCAACAAT
CACCAAAAGAATTACAACTTCTACACCGATTCGAATCTCGAAGAGGCAAGGAAGCTGGTTGCTCTCGCGCTTTCT
GTTCAAGCCCGCTTTGCCCAGATCCAAACTGCCTGGCCTGAACATGTTGTCCTCGCTGATGTCATTCAATGCTGC
GTGCAAATCCTTCAATTCAAGCACACTGAACCTGTTGCCAAGTTCATGACCAAGGTTGAAAAGCTTCATTCATTC
GTACATGAGTGGCAGACCGTGGCCAGCAGAGAATATTCAGCTGTTACCGTCTACGACGAGATTACATCTATTCTC
ATTAGCTGGCGCCGTCTTGAGCTGTCAACTTGGGCTAAGCTCTTAGATATCGAGAAAGAGCGATGCGAGGACGAG
GTAAGTGCTTGGTGGTTCATCGCCTATGAAGTACTCATCGGCGCTCCCATCATGATGGTCGAGGCAGGCGAACAA
GACATGACCGAACACACCCAAAACTTGGTCTTGACTCTAGAGCAATTCTTCAATTCTACAACTACAGGGCAGTTT
GCTCGCCGTCTACAGCTTGTTGCAAACTTCCAAGCATTGCTTGAAGTTTTCACCACAGATTATCCCTGCCTCAAG
AAGCTTGTCTCTGCCTTGGACAACTTCCTCCACCACTACGGACCCTTCCAGCCTGGGGTGGACAAGTATCTGACG
GAGAAGCGGTCGGTTCTTGAGAAGGATATCAAGGAGCAAATTCAGCTTGCGAGCTGGAAAGATGTCAACATTGTG
GCTTTGAAGGAAAGCGCCAGAAGGTCGCATGTGAAACTATTCAAGTTGGTTCGAAAGTACCGTGCAGCCCTTGGC
CAGCCAGTTCAATCAATCCTTGAAGCAGGCCTTCCGGAAAGCACGGAGGAGATCACTTCCATGTCACAAGCAGAG
CCGGTTCGCCCCACTGCCACGTTCCCCGAGGCAATGGCCATTTGTCAAAATGATAAAAAGCTGTGGTCCACTCGA
GCGCTCAGATTTCAGAAGCCGGATGGAACAGCCAACAACATGATGAATTTGTATTCTTCAATTCCAGCCGAGTTC
GACATTGCGAAGGATCTCGACAGCTTCATTGTCTCCGTGATTGAAAGTATGAATGAGTTCAAGTCCAAGACACCC
AAGGTCCTGAACGAAGACAACAAGGACGACGTCCAGCACCTCAAATCCCAGAAACGCCGTCTCTATGCCGAGACC
CTCAAACAACTATATGAGATGGGTGTGAAACGTAATGCTGGATCGAGTGTGATTGAAACCCAAGAAACAGTTCCT
CAAGTTCTCGCCACTAGTGCCGCCTTTGAGGCTGGCGCTGCAACCTCAACTGCAGTTCAGAGTGCCGACTGGTAC
TTCCACAGACTTCTGGATCTCCTGCCTAAGACCCGCCTAGCGTCTCGCAACTATTCCGAGGAGCTAAGCAACGTC
GAAGTCCACCGAAGCATGGGGTCTATTGAGCATCTCATTCTCACCGTCCGCCGCCAGAGAGGTGTCATTTCGCCT
GCCCTCACAGGCTTGGGCAAGCTGAAGTCTACGCTTGACAAGGTGCAGAACCTTTGGGCAGCGACTTCAAACTAT
CTGTCGCAAGACCATGCTTCTGCATCGGAGAAGCGAACCAATCTAGCTAGAATCGTGGCTTGGCTAGCGCCTATT
CTTGGACTTGCCGCAATGATTATTGGAGTGCATTCCAAGTTCTCGGGAATTGACGCATCTAAGATTGTGGAACAG
CTCCGCGCCAAAAAGGCATCCTTCGATAGCCTACGCAAGTCGCATGAAGCTCTTCCCATGCTTCCTACGAGGATT
GCGTCTAACGCAAACCACGAGATCGCGCAGCAGGCACAATCGTCGCTCGATGAATTGGCGGCTGACTTGAAGCAA
TGGAGTCAAGCTCGCCCTGATCTGTCCTTCGCGCTGGATCAGATTACACCTTGGGTCAAGACAAAGGTTGCTGAT
GTCCCTGAGGTTAATGATGAGAACAGCCTATCCATCCAAGCCTTCGATAGCAGCCTCCTGACGGCCATTGACAAA
ATGCTCATCGGCCTGCAGAAGCTCAAGGATGTGCCTTCTGCCATCACCTTTGATGGATTGCTGTCGAGGAGTGAT
GAGTTCTTCTCTCGCGGTATTAAGGCTGTCCATCTCCCAGAGATCACCGCCGCATTGGAGAAGGTCCTTGACCAA
TTGCACCTCCTGCAAGATCACTCCGCTGGCGGTCTCTCCGTTGCTGCCGCACTGCTCACCAGTATCTTGCCTATC
GCCAACAGATACTACCAAATCTGCCGGGATCTGGCTGATCGGTTCATCGCCGTTCACCGCGAGATCTGTAAGACA
TCCTACATCCTGACCAAGACTTTCAAGCAGGTCGCCTCCGAAGGCTTCTGTAGTCCTGCCGAAGCCTCCCAAGAT
CAAGGCAAGGAAGGCCAGATGGAAAGTGGAACTGGTCTCGGTGAAGGAGAAGGAGCGGAGGATATCAGCAAAGAT
GTTGGTGATGACGAAGATCTATCTGAGTTGGCGCAACAAGAGAACAAGAAAGAGGACGGTGATGATGAGATGGAT
GATTCCAAGGATGCTGTCAACATGGATCAGGAAGAGTTGGAAGGTGATGCCGAGGATCGCAAGGACGAGGAGGAG
GAGAACGACGACAGTGCCGAGGAAGGAGATGACGATATCGACGAAGAGACGGGAAGCGTTGATGACCTTGACCCT
GGTGCTGTGGATGAAAAGCTCTGGGACGGTGGTAATGATGAGCAGCAGAAGGATACTGAGAATGAAGAAGGAAAG
GGCCAATCGGAGGCCGAGCAACAAGCTGCTGCTCAGGAAGAGAAGGGCGACAAGGATGAAAATGGTGAAGAAAAG
CAAAAGGAAGGAGAGGAAGAGGAAGAGGAAGAAACAGAAGATGAAGAGGCCCCCGAAGACGAGGGTGAGGCAGTT
GGACGTGAAGAAATGGACGTCACCGACCCTCAAGCAAAGGAAGAAGAAACACTTGAACTTCCCGAGGAAATGCAA
CTTGATGATGGTGAAGGCAAGGATGACAATGGCGAGGACGACGATGACATGGATGACCTTGACGACGATTTCGGT
CCCGCCCCCGAAGAAGAAGCAGAAGGGAAGGACGAAGATGTCAATGATGAAGCCGGCGAAGAAGATGCCGAGGCA
GCAGAAGATCAAGTGCCAGGTGAGGAAGATGAAGAAATGGCCGATGATGCGGAGGAAACCAACGAAGGCGAAGCC
GGAGAAGAGGAGGAAGAGGAAGCTGGTGGCGAAGATCCCGAGGAGTCTGAGCAAGACGACTTCCTCGCACAGCGT
GATGAGAATGATGCCGCAGGTGACAACGTCGCTCCTAGTGAAGCTGTTACTGGCGGGCTCGGAGCCGAGCAAGAC
CAAAATGAAGAAAAGGGTGCATCGGGTGACGCTCAGCAGGAGAGCGGCTCGACTGATCCCAGTGCCAATGTCGAC
CAACAGACAGGCGCTGCTAAGGATAGCGAGGAGAGCCAGCCCAGCCGAGACGCTGCTGGCGGCGAAGATCACGGG
CCAGATGAACCTCAGATGCAGGCATTCAAGAAGCTCGGTGATATCCTCGAGCAATGGCACCGACGACAAAAGGAG
ATTCTCAATCCATCTCAACAGGAAGAGGAATCCCAAGCTATGCCCCAAGACACTGATATGGCCGACGCGGACTTT
GAGCACCTAAAGGATGACGATGATGCCGCAGACACCCAGGCCCTTGGACAAGCAAACGACGACCAAACGCAAGCC
CTCGACCAAAGCAAGGGTGTGGAGTCCGACATCAAGCCTGGCGAGAACGATGTTCTCCCAGACGTGTCGGACGAG
CAGCAAGATGCCGTGGACAACCAGCTTGAGGATGAGATGGAAATCGACCGCGAGAATGTTCCCACAGATGGCGAG
TCCGTTGGCGCCTTCATTCCTAGCGGTCAATCATCCCACGATCGCGCAGACGGAGCACAAGGCACCGAAGAAGTG
GACGAGGAACTGGACGAAGTTGACTCGCAACTCGCAGCAATCCATCTCTCCTCTTCGCTTCCCCCATTGACTCCA
CAAGACGAAGCCCGCCGCCTCTGGTCGCACTATGAGTCTGCCACAAACGACCTCTCCCTCTCCCTGACCGAACAA
CTCCGTCTCATTCTCGCCCCCACAATGGCCACCAAGCTCCGCGGTGACTTCCGCACTGGAAAGCGGCTGAACATC
AAGCGTATCATTCCCTACATCGCATCCCAGTACAAGCGCGACAAGATCTGGATGCGCCGCTCTATCCCCTCAAAG
CGTAACTACCAGATCATGCTGGCCGTCGACGACAGCAAGTCTATGCTGGAAAGTGGCAGTGGTCAGCTCGCCTTT
GAGACCCTCGCCCTCGTTGCCAAGAGTCTGAGCATGCTGGAAGCTGGTGACTTGTGTGTTCTCGGCTTCGGTGAC
GAAGAGCACGTTCGTGTCGCCCACGAATTCGGAAAGCCTTTCTCCTCCGAGGCAGGCTCCCAGGTCTTCCAGCAC
TTCAGCTACCAGCAAACTGGTACCAATGTGCGCAAGCTGATTGCCGACTCTATCGCTCTCTTCCGCGAGGCTCGC
TGGAAGCGCTCGCCTGGTTCCGGCTCTGCCGATCTCTGGCAGCTTCAGTTGATTATCTCTGATGGTATCTGTGAA
GACCATGATACCATTCGCCGTCTTGTCAGGCAGGCGCTTGAGGAGCGCATCATGGTTGTCTTTATTATCGTCGAT
GCTGTCAAGGGTAGCTCCATCCTTGACCTCTCGCAGGCTAGCTTTGAGGCCGATCCTGGCTCTGGTGGTGAGATG
AAGCTCAAGATGAAGCGATACCTCGAGGACTTCCCCTTCCCTTACTACCTTGTCGTTCGTGATGTGAAGGAGTTG
CCCTCTGTTCTGGCCACTGCACTCAAGCAGTGGTTCGCCGAAGTTGTGGATGTGTCGTCTTGA
Gene >Pro_DTO377G3_2|g9665.t1
ATGGATCGGAGGCCGGTCTATGAGAGGACTCTTACTGAGTCCGAACTTCTCGAGCAGCTTCCGAGTGGAATCTCG
ACTTTCATTCGGACTGCATCGGGGACGCAACACCTCCACGCTCTTGCGCTTGGCGCATTAAACAACGAATTTACA
GAGAGCATTTTCAGACTATACGAACCGATTTTCGTCGATCTTGCAGCTAGATGGCTTCAATCGGATTTACATGCC
GACTACATTCATGTATTAGCGGCATTCGCGCAGATTTTACCATTTGCGCCGCACCTGCGCTCGCTTGCCAGTCAA
TATGCCTCATCACAGACTGGACCTTTGGTGGCTTTGGCCGTGTCGAAGGAATTAACACTGCTACAATTGGATCAA
GTTAGCATTAGACTTCTACTCCTCGCCCTCTTCCGACTTCTTTCATTTGATCTTGAAACCTTCTCTCCCATCATT
TCACCGCTTCAACTGCAGTCCCTCTTCCAATCCCAAGATCGAGTAACACGATACCTTGCTGTACGATGCTTTGCC
TTATATATGCACGCAGCCGATGCGGCAACCGAAAAGATGGTCCGCGTCAATACCGGGACTGAGCCTATAGAAGGA
GAGTGGGAAGGCACTCTGATCGATTACCGTGTGCTAGGATTGTGGGAAGAACGCCGATGGGAGACTCTTGGGGGA
ATTATTCGGGCCGAGAGGACTTCCAGGACGGAAAACAACACCCTGGCGTTGATCGAGAGGACACGGGACTCTTTC
ACAACCAAGACCGCAGAAATCTGCGGTGTTTTGATTCCCAGGTTGAAAGATACACCCGCGGCTCCTTCGTCTGTC
GTCAAGACTACTACCACAGTTGAAAATCTGCGCCGAATTGCAGGGTCATTACTCGGTTACAAACCCATCCTGCTG
GTCGGTTTGCCCAACTCCGGGAAGACCTCTTTGATTAATGATATTGCTGCCACGATGGGCCAGATTGAAACTATG
GTCACACTTCACTTGAACGAACAGACAGATGCGAAGAGTCTGCTTGGAATGTATGCCACTTCATCTGCCTCCGGA
TCATTTTCTTGGCAGCCTGGTGTATTGACCAAGGCTGCACGCGAAGGTCGCTGGGTGTTGATTGAAGACCTTGAT
CGTGCTCCATCTGAAGTAATGGGCCTCATTCTCCCGATCATTGAGAGGGGCGAGCTCACTATCCCGAGCAGGAGG
GAGCGAATCAAGTGTGCCGAGGGCTTCAAAATCATCGCAACCATGAAGTCATCGTACAACATTGCCGGCGAGGAG
ATCGCACCGAGCAATTCAATGCTCGGAAGCAGACTCTGGGAGAGAGTGCAAGTCAAGTCTCTTCCCGTGGATGAG
ATGCGTGATGTCATCCTGCAAAAGTTCTCTTTGCTTGAGTCTCGTGTGCCAACTCTCATGAACGTCTACGGACGA
GTATGCTCTGCATTCCATGGAAGTCTTGCGATCAAGGGCTCTCAAGGCCGTACCCCGGGCTTCCGCGATTTGATC
AAGTTGTGCAACCGTCTGCACAATCGCCTACACCGCATAGGTGCGAAGACTGGCTATGAGCCCACGTCAGAAGGT
ACCGAGGATGAAATATTCCTCGACATTGTTGACGTGTTCCTCCGGTATCTGCCCGAGAAGTCAATGCAAAGCACT
CTCGCCGCCGTTGTGGCCGAAGCGCTTCAAATTTCTCCCCAGCGAGCGCAATATTGTCTCAATGAACGCACCCCC
TCTTATATCGACAAGAACAACAGCCTTGTTCTTGGCAGAGAAACCTGTAACAAGATCAAAGTACCAAGTGGATCT
GCATTGAAGCTTGCCGCAGCAGCTTCACGATTTGCCCCCACCCGAGCGGCATTAACCCTCATGGAACAGGTAGCT
GCCTCAATCCAGATGGCAGAGCCTGTTTTACTTGTTGGAGAAACTGGTATCGGAAAGACCACGGTCATCCAGCAT
CTTGCATCTTTGATGCGTCAGAAACTCACAGTAGTAAATTTGTCACAACAGAGTGAAAGCACTGATCTGCTGGGT
GGTTTCAAACCCGTCAACATCCGTACAATGGCAGTTCCAATGCTCGATGAATTCACTCAGCTCTTTGAACTGACT
TTCTCGGCCAAAAAGAACCAGAAGTTCTTGTCGTCCATATCGAAGAGTGCCGCGTCTTCCAATTGGGTACGATTG
GTGACCTTGTGGCACGAAGCCGTTCGTCTTGCAAATGGAGTGTTCAATCCCTCGAATGCCACAGGGGAGAATGGC
GATGAACAGCCAGCCAAAAAACGGAAGCTGGATTCTCCCAAATACCAGCACTTGCGGCAAAGATGGGAGAGCTTC
GCAACACAGCTCGGAGATTTCGAGGCTCAGGTCTCACAAGGTGATGCCAAATTTGCCTTTGCCTTTGTCCAAGGT
AAGATTGTGAGAGCCCTACGAAACGGCGAATGGGTCCTCCTGGATGAAGTGAACTTGGCTTCCCCTGATACCCTT
GAGAATATTGCCAGTCTTCTGCACCACGGAAGTGAGGGAACGCCATCTGTTCTCCTCTCCGAGGCTGGCGATGTT
GAGAGAGTCTTCGGCCACCCGGAATTCCGTATCTTCGGTGCTATGAACCCTGCAACAGATGCTGGAAAGAGAGAC
CTTCCCCCCGGTTTGCGTTCTCGGTTCACCGAATTCTACGTACACTCACCCGATAGCGACTTGGATGATTTATTG
GCTTTGATCCAGAAATACCTTGGTGATTTGACAATCAGTGACCAGCGTGCCGTGCCAGACCTCGCACAGCTTTAC
ATGGTGACCAAGAAGCTCAGCAACGAGAACAAGCTTACTGATGGAGCTGGACAGCGACCTCATTTCAGTATCCGT
ACTCTTGTGCGGGCCTTGATCTATGTCATCGACCACGCACATGTCTACGGGCTACGCAGGGCAATGTTTGAGGGT
TTTAGTATGAGTTTCTTGACCGTGCTGAGCTTGGTCTCCGAACGGGCTTTGATACCTCTACTTGAGCTTCATATC
TTTGGGAACGCGAAGAACGCCAAGTCTCTTCTCGGACAGACCCCCCGCCCACCAACTGATGGCAATGATTATGTG
CAATTCAAACATTACTGGATGCGCCGCGGTCCTATGCTCCCGGAGGAGCAGCCACACTACATTATCACCCCATTC
ATTGAGAAGAATCTGAAGAACTTAGTCCGGGCTAGTTCAACTCGGCGATTCCCCGTTCTGCTCCAGGGTCCGACA
TCAGCCGGAAAGACGAGTATGATCGAGTATCTGGCAAAGGTGTCTGGAAACAAATTTGTACGAATTAACAATCAC
GAGCATACAGATCTGCAAGAGTACCTAGGGTCTTACATCTCGTCAGACGATGGAAGCCTGCGTTATCAAGAGGGT
GTGTTGGTGGAGGCGCTGCGGAACGGTTATTGGATTGTGCTGGATGAGCTGAATCTAGCGCCTTCTGATGTTCTT
GAAGCCCTTAACCGACTCCTCGATGATAATCGTGAGCTTTTCATTCCCGAAACTCAAGAAGTTGTCCACCCGCAT
CCGAACTTCATGCTGTTTGCCACGCAAAATCCCGCTGGTCTGTACGGTGGCCGAAAGGTCCTATCCCGTGCCTTC
AGGAACCGTTTCCTCGAGCTGCACTTCGATGACATTCCAGAAAGCGAGCTGGAATTTATTCTGAAAGAACGTTCT
CAGATCGCTCCCTCCTTCTGCACGCGGATTGTTGAAGTTTACCGGAAATTGTCCTTGCTGCGTCAGTCTAATCGA
CTCTTTGAGCAAAAGAACAGTTTTGCCACTCTGCGTGATCTTTTCCGATGGGCTCTTCGTGATGCCGATGATCGC
GAGCAGCTAGCAGTCAACGGTTATATGCTTCTCGGCGAGCGTGTTCGAAATCCCCAAGAGAAAGCCGCCGTCAAA
ACCGTGATCGAGGAAGTGATGAAGGTAAAACTGGACGAGGATACTTTGTATAGCTCTGCAGAGCTGGAAAAGAAT
GCTCCTGAGATGAGCGAGCTTCCAATTGGTATTGTGTGGACTAAAGCCATGAGACGTCTATTCATTCTCGTTTCG
AAGGCCCTCAAGAACAACGAACCAGTCCTTCTTGTCGGAGAAACCGGTTGCGGTAAGACCCAGCTATGCCAGGCC
GTCGCTGAAGCTTTCCGACGCGAGTTGTTCATTGTCAACGCTCATGTCAATTTGGAGACCGGCGACTTGATTGGT
GCTCAACGGCCTATCCGAAACCGGGCTGCTATCGAGAAACAGCTTGTAGATGACCTTCAAATTCTCCTTCACGGG
CAGCTGAGCGGCGCGTCTTTCGATGACTTGAAGCAGGAATTCACAGCATTGACCGCGGAGCAGCGCCAAGCCAAG
GATCAGCTTCTCTTGAAGAAGATTGAGAAGAACGCTATTCGCTGCAATGCCCTGTTTGAATGGTCCGACGGAAGC
CTGATTACCGCCATGAAGACCGGTCAATTCTTCCTTCTTGACGAGATTTCTCTCGCGGATGACTCCGTTCTTGAA
AGACTCAACAGTGTTCTGGAACCTGCTAGGTCGATTCTTCTCGCTGAGAAGGGCCCCGTTGATTCAATGGTTGTG
GCAGATGGTGGATTCCAATTCTTATCCACTATGAACCCCGGAGGTGATTACGGAAAACGTGAGCTTTCGGCTGCT
CTTCGCAACCGCATGACAGAAATCTGGGCACCTCAGCTGTCTGAAGATGAGGACATCTTGCCGATCCTCTCACAG
AGATTGGATCTGAAGGATGAGAGCGTCGCAACGGCTATGCTGCGATTCGCCAAGTGGTTTAAAGTAACCTTCCAG
AACTCCTCTGCCACATCGCTCTCGATTCGTGATCTTCTTGCCTGGGTTGACTTTGTCAATACTTGTCAAAGAGCA
GACACCCCATTTGCTATCGTACAAGGTGCTGCGATGGTCTTCGTCGACACCTTGGGTGCGAACCCTGCCGCAATG
CTTGCCATTTCCCTCAACAATCTTGAGGGCAACCGCAAGTCATGTCTCGACAAGCTGAGCGAACTGTTCAATGTC
GATGCTTCCAAGATCTACTGGGAATCGACCACCGTCTCCGCGGAACCCGGCGTTCTGCGCGTCGGACCATTTGCT
CTACCTACGGCTGGTACAGCAGACCCCGATCCTCAATTCACAATGGATGCCCCAACTACAATCGCCAACTCTGTG
AGAATTGCTCGGGGTTTGCAGTCATCGAAGCCTATCCTTATGGAAGGAAGCCCAGGTGTGGGTAAGACTACACTT
GTGACGGCTCTGGCCAGAGCTCTTGGCAAACCTCTCACTCGAATCAACCTCTCGGAACAGACAGATCTTACAGAC
CTATTCGGTTCAGACGTTCCAGTGGAAGGAGGAGATGTCGGGCAATTCACTTGGCGTGACGCTCCATTCCTACGA
GCCATGCAGCGTGGTGACTGGGTTCTGCTCGATGAAATGAACCTGGCCTCGCAATCTGTCCTTGAAGGTCTCAAC
TCTTGTCTCGATCATCGCCAGCAGGTTTATATCGCTGAGCTGGACCAGACATTCAAGAGACACCCCGATTTCGTT
CTCTTTGCCGCTCAAAACCCTCACCATCAGGGTGGTGGCAGAAAGGGTCTCCCTGCATCTTTTGTCAACCGATTT
ACAGTGGTCTATGCAGACAGCTTCACTGACGATGACTTGAAAACGATTTGTTCCAGACTTTTCCCTGGCAGTCCC
TCTGTGCAGACCGAGAGATTGGTTGATTTCATTTCCCTCTTGAACCAAGCGATCACACGAGATCGTCGGCTGGGA
ACCATCGGTGGGCCATGGGAAGTCAATCTGCGTGATATCCAGCGATGGCTTCAACTTGCCGATCGAGGAAACCTA
CAGATCCAGACAAAGCACTTCCTTAATGTCGTTATCAGCCAGCGATTCAGAAGCGAAGAGGATCGTAACGTGGTC
TCTCAGATTTATGACCGTGTTTTCACAGACTCTGATACTGGCTCGGAGAGCTACTTCCACAACCTCACACCTGAA
TACTTGCAAGTCGGTCTGGGCGTTTTGACCCGTGACCCTCTGCTGCAGCGCTTGGCCGAACCAAACATGAGGATT
CTACCAAATGATCTTCATATTGCCGAGTCGCTCATTTTGTGTATCGATAACTCCTGGCCGAGCATCTTAGTTGGT
CCTGCTGGGTGTGGCAAGACTACTCTCATCAGAAAGCTGGCAGCGGTCAACGGTGCAAACCTTGTCGAGCTAGCT
TTGAGTTCTGATACTGATACTATGGATCTAATTGGTGGATTCGAACAAATCGATCATCGCAGAGAGGTTTCAGGC
TTTGTCCATGATATTGAGATGTTCTTGCGAAACCAGCTCATCCAATGCTTTGCTTCAGGGGATGTATCTGATGTT
GTGATTTCTGCACTCCAAATTTGCGAGCATTTCCAGTCTGCAGATATCTCGCTGGAAAATGTCATCCCCTCGCTT
TCCAGCCTTTGCCAGTCTTCTTCCGACCCTGTCTACCAACAATTCCTCGAGAGAGCCCAAACCTTGTTAAATGCA
ATCCAACAATCCGATAAAATGAAGGTTGGATTTGAATGGACAGAAGGTGTCCTCACTCAGGCTGTTCAACATGGA
AATTGGGTTATTCTTGACAATGCTAACCTGTGCAACCCATCCGTCCTCGATCGACTGAATTCGTTGACGGAACCG
AATGGCACACTCATTCTCAATGAGCAACGGACAGACGATGGATCTGCCAAGGTTATCACGCCCCATGTCAACTTT
AGAATCTTCTTGACAATGGACCCCCGCAATGGCGAGCTGTCTCGTGCCATGAGGAACCGTTGTACCGAAATCTGT
TTCTTGCCAAGTGAGATGCAAGACATCCAACCTACCATAGGCCCATCTTACACCTGTGAATCGTTCCTCTATCGA
CTTCGCCATATTTGGAACTTGGATACCTCCTTGCCATCGTCTGCCTTTGAAGACGCTCTCGAGGTGTGCTTGGAT
CATCTTTCACCAGCGGATCTGGCCTACCTTCAACAGTCACCAAGCAACCGTGTGGCTATCAACTCCGAGCACAAC
GGAGAAGACAAGCCATCCAATGTTCTGCAGCGCTATACCTCTCTGTTCCATGACAACAACCAATGGAAGCCGCTT
GACATCGCCAGCGGCGAGATTGTGCTTGGTGGGGCCCACCTTGGTATCCGAGGAATGTTGCAGCCTCTTCACCCG
CTTACAAATGAGCCTCTGATAGCTATTGCAGGAACCAGTGATTTCCGGTCTAGTTTGATTGTCTTGGCTTATCTT
CAGGAGCTGAGACTTGATATTCATCGCCTCAGGGAAGGTTTGATTCAAGCCGACGTATCCGGAAAAGAGCTCAAG
CCTAGCCAAATGACACGTTTGGAGCGGTCATTGGCATCTGAGCGGATCCCTGCGTTGATGAAAGACACAACGCAA
CCTGTTGCCTCGTTCTTGTCTGATTGTGGCCAGGCTCTGTATGATTACATTCAGTCGTTGGATCAAATCTCTCTC
CAAGGCCCTGTAATAATCGCAGCCCTTCGGACCGTTATCTGTCTATGCTGGGACATTTACAGAGCCACAGAGGTT
AGTCAGGTTGATGAAGGAGAATTCCAAGTCTACCTTCAGATGGGCCGAAAGATCTGCGGGTCGTTGCTCGACTCG
TCCCCTCTTCTCAACCCGCTCCAAGTCGCTTTATCACAGGCCCTGGATCGATTCCAGGAAGGGTGGGCTTTGACG
ACTGGTCTTAGCATGCAAAGAATCTGGGATTCTTGGAGACATGTCACTCCTATCTCTCAAGATAAGTTGAATTCT
CTAACCGAGTTGGAGTCAACAGTCTTTGATTTCACAACTTTGGCTTTGCAAACCCGTGTGGAATTGTCTCAATTG
AGTCGTGTGCGCAACTCATTGATTGATGCCCAGCGATTCATTCTTCTGGATGGTGCTGATGGTGACGTACTTGTT
CAGGTATTTTAGATCTGCTGCCAAACCCGAAGAATTATATATGCTAACTATGAATAGGGTATCAAACAAACCGTC
GCTGAGCTATCTCATGCAGTTCGACGTTCAGAGTCAACCGAGTATCCATACTTTGCAAACGATTTCGAAGCTCTT
TGCCAGTACCACGACATCTCCTCATTTTTCCAGAACCCAGTCCACGATACTGTCATCCAGACAGTCCTGCCACTC
CTCGCTGGTCGTGCGGCTCGTCCATTAGACACGTCGAATTTCCAAAGCGACGTGCCAAATATTCTCCATAGAATC
TCGCTATTTGCGGGTTCTTCAAGCAAATCCGAGTCTGCGCTTGCTACTGGTGGTATTATTTCTCTGTCGCTATTG
GATAAGCTGGCAACTATCGGCAATACAAAATTGGGGCAGATGGACATGCTTGAGGCAGAGAAACAGGCTCTCTCC
AAGGCTATTTCCTTGAGCAGTCAACAGATCACAACAGACCAGTCCATGGTCCTTGGACGTACTATCGCTAAGCTC
ACAGCCGAGCTGGTGGCTTGTCATCGGGAGTTCTTCGAGCCTCGCTCAGCCGAGGATCTCATCTCTGTTCTGCAA
GCGATCCAAAATGGGGATCTTTGCGTTGAACAGTCACCTATCAAGGTTGAACTAGACCAAAGCTTGCCAAATGCT
CTCTTCTTTAGGCCCCTCGCCGAACAGGCTCTACCGGCTCTGATTTCGTCCCTCCAAGCATCAAGCCAGCAGCAG
AGCATTCGAACCACTGGACTGGCAGCAGTACAGCTAGCAGTCATTCTTCTGCGTCTATTCGTCCCCGACAAGACA
TTTGACCCTTCTCTCGGTCTCGTTGTTCAACGCAAACGCCACTCTCAACGTCTGCAAGAATACACGGCCAAGTCT
GCAGCAATTCTTGCCTTTGAGAAGTCTTTCACCAACCAGGTTTCCAACCTCCGGTCTGAACTTCTGCACAATGAA
ATCCGTGATCTAGGTTCTGCCCCCCCTCCTTCACTGGTAAACCGGCCCCAGCAGTCCCAGTTGAGTCTCTTGCAG
GGAGAGTTCGTCAATTTAATCAACACTGTCCTGAAGAGAGACCCGGAGCAAATGGTCCGCTCTGCCGAATCTTCG
CAGTCCCAAGACATGATCCAGCTTCTGCGTAATAACATCAAACAATTGAGCAGTCGTCTTAGCACTCACTACAGA
TCCTATGACGATATAACCGTGCCCGTGGTTCGTTTCTTGCAGCTTTTGGACCTTGGTGTGTTCTTGGCGTCTAGC
CAGCCGGAACAGTCTGGCGATATTCCTGATATTCAGTCTCTGAGCGCGCGAACACCCTTTTTAGGAGGTATCCAC
CACCCCGTTCTTGCTCAGGATGATCGGAAGGCCCCTGGCACCCTGAAGAATGCAAACGAAATGCGCCTTCAAGAA
CTGTCGGCCCTTTGGGCCGCCAAGGATGCGGATTCCACAATCTTGAATACAAAGGCTGGACGAGATATTATTCGC
CGTGTTTTCGCTGATTTCCATCAACTATGGAAGACTAAGCTCGAAGAAGATCGGGAGCTAGAAGCCGAAAAGGGA
GAATTGTACCGCTTCAAGGGATCCTGGGAAGAGGAAGAAGAAGTCAACGAAGCCGAGCTACATGCACTTTTCCCT
ACATTCGATGAAGGATCAGCTGAAGACACAGAAACGACGGATGCTGCTGACCGTATTGACCCCAAGAGCATCGCT
CTCCGGCTTGCCTCGCTTCATGCAAATATCGTCTCGAATGAGCGCAGTGGAACTGCATTGACTACCCTTGTCAAG
CAATCAGGGCATCTTTTGGGCTCAATCTGGTCTGAAAACAAGACATCATTCTCGCCTATGTCACCCCAGAACCAT
CTTCCTGCAGTTCTTCTACTTCTCGATGATGCCATAGGCGAGGGAACCAACAATCACCAAAAGAATTACAACTTC
TACACCGATTCGAATCTCGAAGAGGCAAGGAAGCTGGTTGCTCTCGCGCTTTCTGTTCAAGCCCGCTTTGCCCAG
ATCCAAACTGCCTGGCCTGAACATGTTGTCCTCGCTGATGTCATTCAATGCTGCGTGCAAATCCTTCAATTCAAG
CACACTGAACCTGTTGCCAAGTTCATGACCAAGGTTGAAAAGCTTCATTCATTCGTACATGAGTGGCAGACCGTG
GCCAGCAGAGAATATTCAGCTGTTACCGTCTACGACGAGATTACATCTATTCTCATTAGCTGGCGCCGTCTTGAG
CTGTCAACTTGGGCTAAGCTCTTAGATATCGAGAAAGAGCGATGCGAGGACGAGGTAAGTGCTTGGTGGTTCATC
GCCTATGAAGTACTCATCGGCGCTCCCATCATGATGGTCGAGGCAGGCGAACAAGACATGACCGAACACACCCAA
AACTTGGTCTTGACTCTAGAGCAATTCTTCAATTCTACAACTACAGGGCAGTTTGCTCGCCGTCTACAGCTTGTT
GCAAACTTCCAAGCATTGCTTGAAGTTTTCACCACAGATTATCCCTGCCTCAAGAAGCTTGTCTCTGCCTTGGAC
AACTTCCTCCACCACTACGGACCCTTCCAGCCTGGGGTGGACAAGTATCTGACGGAGAAGCGGTCGGTTCTTGAG
AAGGATATCAAGGAGCAAATTCAGCTTGCGAGCTGGAAAGATGTCAACATTGTGGCTTTGAAGGAAAGCGCCAGA
AGGTCGCATGTGAAACTATTCAAGTTGGTTCGAAAGTACCGTGCAGCCCTTGGCCAGCCAGTTCAATCAATCCTT
GAAGCAGGCCTTCCGGAAAGCACGGAGGAGATCACTTCCATGTCACAAGCAGAGCCGGTTCGCCCCACTGCCACG
TTCCCCGAGGCAATGGCCATTTGTCAAAATGATAAAAAGCTGTGGTCCACTCGAGCGCTCAGATTTCAGAAGCCG
GATGGAACAGCCAACAACATGATGAATTTGTATTCTTCAATTCCAGCCGAGTTCGACATTGCGAAGGATCTCGAC
AGCTTCATTGTCTCCGTGATTGAAAGTATGAATGAGTTCAAGTCCAAGACACCCAAGGTCCTGAACGAAGACAAC
AAGGACGACGTCCAGCACCTCAAATCCCAGAAACGCCGTCTCTATGCCGAGACCCTCAAACAACTATATGAGATG
GGTGTGAAACGTAATGCTGGATCGAGTGTGATTGAAACCCAAGAAACAGTTCCTCAAGTTCTCGCCACTAGTGCC
GCCTTTGAGGCTGGCGCTGCAACCTCAACTGCAGTTCAGAGTGCCGACTGGTACTTCCACAGACTTCTGGATCTC
CTGCCTAAGACCCGCCTAGCGTCTCGCAACTATTCCGAGGAGCTAAGCAACGTCGAAGTCCACCGAAGCATGGGG
TCTATTGAGCATCTCATTCTCACCGTCCGCCGCCAGAGAGGTGTCATTTCGCCTGCCCTCACAGGCTTGGGCAAG
CTGAAGTCTACGCTTGACAAGGTGCAGAACCTTTGGGCAGCGACTTCAAACTATCTGTCGCAAGACCATGCTTCT
GCATCGGAGAAGCGAACCAATCTAGCTAGAATCGTGGCTTGGCTAGCGCCTATTCTTGGACTTGCCGCAATGATT
ATTGGAGTGCATTCCAAGTTCTCGGGAATTGACGCATCTAAGATTGTGGAACAGCTCCGCGCCAAAAAGGCATCC
TTCGATAGCCTACGCAAGTCGCATGAAGCTCTTCCCATGCTTCCTACGAGGATTGCGTCTAACGCAAACCACGAG
ATCGCGCAGCAGGCACAATCGTCGCTCGATGAATTGGCGGCTGACTTGAAGCAATGGAGTCAAGCTCGCCCTGAT
CTGTCCTTCGCGCTGGATCAGATTACACCTTGGGTCAAGACAAAGGTTGCTGATGTCCCTGAGGTTAATGATGAG
AACAGCCTATCCATCCAAGCCTTCGATAGCAGCCTCCTGACGGCCATTGACAAAATGCTCATCGGCCTGCAGAAG
CTCAAGGATGTGCCTTCTGCCATCACCTTTGATGGATTGCTGTCGAGGAGTGATGAGTTCTTCTCTCGCGGTATT
AAGGCTGTCCATCTCCCAGAGATCACCGCCGCATTGGAGAAGGTCCTTGACCAATTGCACCTCCTGCAAGATCAC
TCCGCTGGCGGTCTCTCCGTTGCTGCCGCACTGCTCACCAGTATCTTGCCTATCGCCAACAGATACTACCAAATC
TGCCGGGATCTGGCTGATCGGTTCATCGCCGTTCACCGCGAGATCTGTAAGACATCCTACATCCTGACCAAGACT
TTCAAGCAGGTCGCCTCCGAAGGCTTCTGTAGTCCTGCCGAAGCCTCCCAAGATCAAGGCAAGGAAGGCCAGATG
GAAAGTGGAACTGGTCTCGGTGAAGGAGAAGGAGCGGAGGATATCAGCAAAGATGTTGGTGATGACGAAGATCTA
TCTGAGTTGGCGCAACAAGAGAACAAGAAAGAGGACGGTGATGATGAGATGGATGATTCCAAGGATGCTGTCAAC
ATGGATCAGGAAGAGTTGGAAGGTGATGCCGAGGATCGCAAGGACGAGGAGGAGGAGAACGACGACAGTGCCGAG
GAAGGAGATGACGATATCGACGAAGAGACGGGAAGCGTTGATGACCTTGACCCTGGTGCTGTGGATGAAAAGCTC
TGGGACGGTGGTAATGATGAGCAGCAGAAGGATACTGAGAATGAAGAAGGAAAGGGCCAATCGGAGGCCGAGCAA
CAAGCTGCTGCTCAGGAAGAGAAGGGCGACAAGGATGAAAATGGTGAAGAAAAGCAAAAGGAAGGAGAGGAAGAG
GAAGAGGAAGAAACAGAAGATGAAGAGGCCCCCGAAGACGAGGGTGAGGCAGTTGGACGTGAAGAAATGGACGTC
ACCGACCCTCAAGCAAAGGAAGAAGAAACACTTGAACTTCCCGAGGAAATGCAACTTGATGATGGTGAAGGCAAG
GATGACAATGGCGAGGACGACGATGACATGGATGACCTTGACGACGATTTCGGTCCCGCCCCCGAAGAAGAAGCA
GAAGGGAAGGACGAAGATGTCAATGATGAAGCCGGCGAAGAAGATGCCGAGGCAGCAGAAGATCAAGTGCCAGGT
GAGGAAGATGAAGAAATGGCCGATGATGCGGAGGAAACCAACGAAGGCGAAGCCGGAGAAGAGGAGGAAGAGGAA
GCTGGTGGCGAAGATCCCGAGGAGTCTGAGCAAGACGACTTCCTCGCACAGCGTGATGAGAATGATGCCGCAGGT
GACAACGTCGCTCCTAGTGAAGCTGTTACTGGCGGGCTCGGAGCCGAGCAAGACCAAAATGAAGAAAAGGGTGCA
TCGGGTGACGCTCAGCAGGAGAGCGGCTCGACTGATCCCAGTGCCAATGTCGACCAACAGACAGGCGCTGCTAAG
GATAGCGAGGAGAGCCAGCCCAGCCGAGACGCTGCTGGCGGCGAAGATCACGGGCCAGATGAACCTCAGATGCAG
GCATTCAAGAAGCTCGGTGATATCCTCGAGCAATGGCACCGACGACAAAAGGAGATTCTCAATCCATCTCAACAG
GAAGAGGAATCCCAAGCTATGCCCCAAGACACTGATATGGCCGACGCGGACTTTGAGCACCTAAAGGATGACGAT
GATGCCGCAGACACCCAGGCCCTTGGACAAGCAAACGACGACCAAACGCAAGCCCTCGACCAAAGCAAGGGTGTG
GAGTCCGACATCAAGCCTGGCGAGAACGATGTTCTCCCAGACGTGTCGGACGAGCAGCAAGATGCCGTGGACAAC
CAGCTTGAGGATGAGATGGAAATCGACCGCGAGAATGTTCCCACAGATGGCGAGTCCGTTGGCGCCTTCATTCCT
AGCGGTCAATCATCCCACGATCGCGCAGACGGAGCACAAGGCACCGAAGAAGTGGACGAGGAACTGGACGAAGTT
GACTCGCAACTCGCAGCAATCCATCTCTCCTCTTCGCTTCCCCCATTGACTCCACAAGACGAAGCCCGCCGCCTC
TGGTCGCACTATGAGTCTGCCACAAACGACCTCTCCCTCTCCCTGACCGAACAACTCCGTCTCATTCTCGCCCCC
ACAATGGCCACCAAGCTCCGCGGTGACTTCCGCACTGGAAAGCGGCTGAACATCAAGCGTATCATTCCCTACATC
GCATCCCAGTACAAGCGCGACAAGATCTGGATGCGCCGCTCTATCCCCTCAAAGCGTAACTACCAGATCATGCTG
GCCGTCGACGACAGCAAGTCTATGCTGGAAAGTGGCAGTGGTCAGCTCGCCTTTGAGACCCTCGCCCTCGTTGCC
AAGAGTCTGAGCATGCTGGAAGCTGGTGACTTGTGTGTTCTCGGCTTCGGTGACGAAGAGCACGTTCGTGTCGCC
CACGAATTCGGAAAGCCTTTCTCCTCCGAGGCAGGCTCCCAGGTCTTCCAGCACTTCAGCTACCAGCAAACTGGT
ACCAATGTGCGCAAGCTGATTGCCGACTCTATCGCTCTCTTCCGCGAGGCTCGCTGGAAGCGCTCGCCTGGTTCC
GGCTCTGCCGATCTCTGGCAGCTTCAGTTGATTATCTCTGATGGTATCTGTGAAGACCATGATACCATTCGCCGT
CTTGTCAGGCAGGCGCTTGAGGAGCGCATCATGGTTGTCTTTATTATCGTCGATGCTGTCAAGGGTAGCTCCATC
CTTGACCTCTCGCAGGCTAGCTTTGAGGCCGATCCTGGCTCTGGTGGTGAGATGAAGCTCAAGATGAAGCGATAC
CTCGAGGACTTCCCCTTCCCTTACTACCTTGTCGTTCGTGATGTGAAGGAGTTGCCCTCTGTTCTGGCCACTGCA
CTCAAGCAGTGGTTCGCCGAAGTTGTGGATGTGTCGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail