Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9659.t1
Gene name
Locationscaffold_55:54058..55611
Strand-
Gene length (bp)1553
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 2.1E-17 176 401
PF14008 Metallophos_C Iron/zinc purple acid phosphatase-like protein C 2.4E-13 423 484
PF16656 Pur_ac_phosph_N Purple acid Phosphatase, N-terminal domain 1.3E-12 33 117

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003993 acid phosphatase activity Yes
GO:0016787 hydrolase activity Yes
GO:0016791 phosphatase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0042578 phosphoric ester hydrolase activity No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.58 0.00 1.26
5d_25C Five days - 25 degrees Celsius 0.85 0.00 1.70
7d_25C Seven days - 25 degrees Celsius 0.86 0.00 1.73
10d_25C Ten days - 25 degrees Celsius 0.30 0.00 0.74
7d_15C Seven days - 15 degrees Celsius 0.46 0.00 1.05
7d_30C Seven days - 30 degrees Celsius 1.54 0.06 3.02

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.633340 no
3d_25C 7d_25C 0.614296 no
3d_25C 7d_15C 1.000000 no
3d_25C 7d_30C 0.118550 no
3d_25C 10d_25C 1.000000 no
5d_25C 7d_25C 0.990703 no
5d_25C 7d_15C 0.397566 no
5d_25C 7d_30C 0.322970 no
5d_25C 10d_25C 0.207981 no
7d_25C 7d_15C 0.381875 no
7d_25C 7d_30C 0.325602 no
7d_25C 10d_25C 0.196488 no
7d_15C 7d_30C 0.060203 no
7d_15C 10d_25C 1.000000 no
7d_30C 10d_25C 0.064657 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9659.t1
MGGILSLKLLPFVASCAFAGVNYPEIPKDLTTPFQQRLTVYGPNAVSVGWNTYEQLNQSCVNYGLSETNLNTKAC
SSSSTTYDPSRTWSNVAVLTGLTPATTYYYKIDSTNSTIGHFLSPRTPGDRTAFTMDVIIDLGVYGKDGFTSKRS
TKKDTIPVIEPELNHTTIGRLAETIDDYELVIHPGDFAYADDWYLKFANLLDGKEAYESIIEQFYDQLAPIAGRK
LYMASPGNHEADCSEIPYLNGLCPKGQNNFTEFMHRYEKTMPQSFISSSPNPTAQTLARTARSLSNPPFWYSFEY
GMAHVVMIDTETDFPNAPSGQGGSAKLNGGPFGTANQQIEFLKADLASVDRSVTPWLIVAGHRPWYSTGGSSNVC
SPCQEAFEGLLYQYGVDIGIFGHVHNSQRFMPVVNGTADPNGMEDPKAPMYIVAGGPGNVEGLGSVGSKPAYTEF
AYADDYSYSTLRFLDEQHLQVDFVRSSTGEILDSSTLYKEHATDFVDQ*
Coding >Pro_DTO377G3_2|g9659.t1
ATGGGGGGAATTCTATCGCTCAAATTGCTGCCCTTTGTGGCTAGCTGCGCCTTTGCTGGTGTCAATTATCCTGAG
ATCCCGAAGGACTTGACTACACCATTCCAGCAACGATTGACAGTCTATGGACCTAATGCTGTGTCGGTTGGTTGG
AACACCTATGAACAGCTGAATCAAAGTTGTGTGAATTATGGCTTGTCAGAAACCAACCTGAATACCAAAGCTTGC
TCATCCTCGTCGACTACCTACGATCCTTCCCGGACGTGGTCAAATGTTGCAGTCCTAACAGGCCTGACCCCCGCG
ACAACCTACTACTACAAGATTGACTCCACCAACTCGACCATAGGCCATTTTCTCAGCCCTCGCACGCCCGGCGAT
AGAACTGCATTCACCATGGACGTGATCATTGATCTTGGTGTCTACGGCAAAGACGGCTTCACAAGCAAAAGAAGC
ACAAAAAAGGACACTATTCCAGTCATCGAGCCAGAATTGAACCACACCACAATTGGTCGCCTCGCGGAAACAATA
GACGACTACGAGCTTGTCATCCACCCAGGCGATTTCGCTTACGCCGACGACTGGTATCTTAAATTCGCAAACCTG
CTCGACGGCAAAGAAGCCTACGAGTCTATTATCGAACAATTCTACGACCAACTAGCACCGATCGCAGGCCGCAAG
CTCTACATGGCCAGCCCGGGAAACCACGAAGCAGACTGCTCAGAGATTCCATACTTGAACGGCCTCTGCCCAAAA
GGCCAGAACAACTTCACCGAGTTCATGCACCGGTACGAGAAAACCATGCCGCAGTCTTTTATTTCGTCGTCACCA
AACCCAACGGCCCAAACCCTGGCCCGAACGGCCCGCAGCCTTTCCAACCCACCCTTTTGGTATTCCTTCGAATAC
GGCATGGCCCACGTTGTGATGATCGACACCGAAACGGATTTCCCAAATGCACCAAGCGGCCAAGGTGGCTCCGCC
AAGCTGAACGGCGGGCCATTTGGCACTGCGAACCAACAGATCGAGTTCCTCAAGGCCGATCTCGCTTCCGTCGAC
CGGTCTGTCACACCTTGGCTAATCGTCGCCGGACACAGGCCATGGTACTCAACCGGAGGATCGTCGAACGTCTGC
AGTCCCTGCCAAGAGGCGTTTGAGGGCCTGCTTTACCAGTACGGCGTTGACATCGGTATTTTTGGGCATGTGCAC
AACTCGCAGCGGTTCATGCCTGTGGTCAATGGTACCGCCGATCCCAACGGTATGGAGGACCCCAAGGCCCCCATG
TATATCGTTGCTGGAGGCCCCGGTAATGTTGAGGGTCTGGGCTCTGTTGGCAGTAAGCCTGCTTATACGGAGTTT
GCATATGCGGATGACTATAGCTACAGTACGCTTAGGTTTTTGGATGAGCAACACTTGCAAGTTGATTTTGTGAGG
TCCTCTACTGGAGAGATCTTGGATTCTAGTACTTTGTACAAGGAACATGCAACGGATTTTGTGGACCAGTAA
Transcript >Pro_DTO377G3_2|g9659.t1
ATGGGGGGAATTCTATCGCTCAAATTGCTGCCCTTTGTGGCTAGCTGCGCCTTTGCTGGTGTCAATTATCCTGAG
ATCCCGAAGGACTTGACTACACCATTCCAGCAACGATTGACAGTCTATGGACCTAATGCTGTGTCGGTTGGTTGG
AACACCTATGAACAGCTGAATCAAAGTTGTGTGAATTATGGCTTGTCAGAAACCAACCTGAATACCAAAGCTTGC
TCATCCTCGTCGACTACCTACGATCCTTCCCGGACGTGGTCAAATGTTGCAGTCCTAACAGGCCTGACCCCCGCG
ACAACCTACTACTACAAGATTGACTCCACCAACTCGACCATAGGCCATTTTCTCAGCCCTCGCACGCCCGGCGAT
AGAACTGCATTCACCATGGACGTGATCATTGATCTTGGTGTCTACGGCAAAGACGGCTTCACAAGCAAAAGAAGC
ACAAAAAAGGACACTATTCCAGTCATCGAGCCAGAATTGAACCACACCACAATTGGTCGCCTCGCGGAAACAATA
GACGACTACGAGCTTGTCATCCACCCAGGCGATTTCGCTTACGCCGACGACTGGTATCTTAAATTCGCAAACCTG
CTCGACGGCAAAGAAGCCTACGAGTCTATTATCGAACAATTCTACGACCAACTAGCACCGATCGCAGGCCGCAAG
CTCTACATGGCCAGCCCGGGAAACCACGAAGCAGACTGCTCAGAGATTCCATACTTGAACGGCCTCTGCCCAAAA
GGCCAGAACAACTTCACCGAGTTCATGCACCGGTACGAGAAAACCATGCCGCAGTCTTTTATTTCGTCGTCACCA
AACCCAACGGCCCAAACCCTGGCCCGAACGGCCCGCAGCCTTTCCAACCCACCCTTTTGGTATTCCTTCGAATAC
GGCATGGCCCACGTTGTGATGATCGACACCGAAACGGATTTCCCAAATGCACCAAGCGGCCAAGGTGGCTCCGCC
AAGCTGAACGGCGGGCCATTTGGCACTGCGAACCAACAGATCGAGTTCCTCAAGGCCGATCTCGCTTCCGTCGAC
CGGTCTGTCACACCTTGGCTAATCGTCGCCGGACACAGGCCATGGTACTCAACCGGAGGATCGTCGAACGTCTGC
AGTCCCTGCCAAGAGGCGTTTGAGGGCCTGCTTTACCAGTACGGCGTTGACATCGGTATTTTTGGGCATGTGCAC
AACTCGCAGCGGTTCATGCCTGTGGTCAATGGTACCGCCGATCCCAACGGTATGGAGGACCCCAAGGCCCCCATG
TATATCGTTGCTGGAGGCCCCGGTAATGTTGAGGGTCTGGGCTCTGTTGGCAGTAAGCCTGCTTATACGGAGTTT
GCATATGCGGATGACTATAGCTACAGTACGCTTAGGTTTTTGGATGAGCAACACTTGCAAGTTGATTTTGTGAGG
TCCTCTACTGGAGAGATCTTGGATTCTAGTACTTTGTACAAGGAACATGCAACGGATTTTGTGGACCAGTAA
Gene >Pro_DTO377G3_2|g9659.t1
ATGGGGGGAATTCTATCGCTCAAATTGCTGCCCTTTGTGGCTAGCTGCGCCTTTGCTGGTGTCAATTATCCTGAG
ATCCCGAAGGACTTGACTACACCATTCCAGCAACGATTGACAGTCTATGGACCTAATGGTAAGAAGACCGGTAGA
TATAGTGGGCTTGGAGAGGACTGACTTATTCATCTTTAGCTGTGTCGGTTGGTTGGAACACCTATGAACAGCTGA
ATCAAAGTTGTGTGAATTATGGCTTGTCAGAAACCAACCTGAATACCAAAGCTTGCTCATCCTCGTCGACTACCT
ACGATCCTTCCCGGACGTGGTCAAATGTTGCAGTCCTAACAGGCCTGACCCCCGCGACAACCTACTACTACAAGA
TTGACTCCACCAACTCGACCATAGGCCATTTTCTCAGCCCTCGCACGCCCGGCGATAGAACTGCATTCACCATGG
ACGTGATCATTGATCTTGGTGTCTACGGCAAAGACGGCTTCACAAGCAAAAGAAGCACAAAAAAGGACACTATTC
CAGTCATCGAGCCAGAATTGAACCACACCACAATTGGTCGCCTCGCGGAAACAATAGACGACTACGAGCTTGTCA
TCCACCCAGGCGATTTCGCTTACGCCGACGACTGGTATCTTAAATTCGCAAACCTGCTCGACGGCAAAGAAGCCT
ACGAGTCTATTATCGAACAATTCTACGACCAACTAGCACCGATCGCAGGCCGCAAGCTCTACATGGCCAGCCCGG
GAAACCACGAAGCAGACTGCTCAGAGATTCCATACTTGAACGGCCTCTGCCCAAAAGGCCAGAACAACTTCACCG
AGTTCATGCACCGGTACGAGAAAACCATGCCGCAGTCTTTTATTTCGTCGTCACCAAACCCAACGGCCCAAACCC
TGGCCCGAACGGCCCGCAGCCTTTCCAACCCACCCTTTTGGTATTCCTTCGAATACGGCATGGCCCACGTTGTGA
TGATCGACACCGAAACGGATTTCCCAAATGCACCAAGCGGCCAAGGTGGCTCCGCCAAGCTGAACGGCGGGCCAT
TTGGCACTGCGAACCAACAGATCGAGTTCCTCAAGGCCGATCTCGCTTCCGTCGACCGGTCTGTCACACCTTGGC
TAATCGTCGCCGGACACAGGCCATGGTACTCAACCGGAGGATCGTCGAACGTCTGCAGTCCCTGCCAAGAGGCGT
TTGAGGGCCTGCTTTACCAGTACGGCGTTGACATCGGTATTTTTGGGCATGTGCACAACTCGCAGCGGTTCATGC
CTGTGGTCAATGGTACCGCCGATCCCAACGGTATGGAGGACCCCAAGGCCCCCATGTATATCGTTGCTGGAGGCC
CCGGTAATGTTGAGGGTCTGGGCTCTGTTGGCAGTAAGCCTGCTTATACGGAGTTTGCATATGCGGATGACTATA
GCTACAGTACGCTTAGGTTTTTGGATGAGCAACACTTGCAAGTTGATTTTGTGAGGTCCTCTACTGGAGAGATCT
TGGATTCTAGTACTTTGTACAAGGAACATGCAACGGATTTTGTGGACCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail