Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9639.t1
Gene name
Locationscaffold_54:64317..65283
Strand+
Gene length (bp)966
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02548 Pantoate_transf Ketopantoate hydroxymethyltransferase 3.2E-105 11 270

GO

GO Term Description Terminal node
GO:0003864 3-methyl-2-oxobutanoate hydroxymethyltransferase activity Yes
GO:0015940 pantothenate biosynthetic process Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009058 biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0006766 vitamin metabolic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009110 vitamin biosynthetic process No
GO:0043603 cellular amide metabolic process No
GO:0015939 pantothenate metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0003824 catalytic activity No
GO:0016742 hydroxymethyl-, formyl- and related transferase activity No
GO:0072330 monocarboxylic acid biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 20.21 8.85 31.57
5d_25C Five days - 25 degrees Celsius 14.62 5.78 23.47
7d_25C Seven days - 25 degrees Celsius 16.93 7.04 26.81
10d_25C Ten days - 25 degrees Celsius 13.82 5.18 22.47
7d_15C Seven days - 15 degrees Celsius 19.77 8.45 31.08
7d_30C Seven days - 30 degrees Celsius 13.74 5.29 22.19

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.373222 no
3d_25C 7d_25C 0.656497 no
3d_25C 7d_15C 0.963673 no
3d_25C 7d_30C 0.260662 no
3d_25C 10d_25C 0.270785 no
5d_25C 7d_25C 0.741215 no
5d_25C 7d_15C 0.408258 no
5d_25C 7d_30C 0.904444 no
5d_25C 10d_25C 0.913783 no
7d_25C 7d_15C 0.703919 no
7d_25C 7d_30C 0.610954 no
7d_25C 10d_25C 0.623514 no
7d_15C 7d_30C 0.298033 no
7d_15C 10d_25C 0.309666 no
7d_30C 10d_25C 0.991294 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9639.t1
MGSTTTSTRKKVTIQTIQNLYKKNEPITVLTASDFPSGHVADTAGMEIVLVGDSLAMVAMGMEDTNEVTMDEMLL
HCRSVNRAVKSAFTIADLPMGSYETTPEKALTSAIRMVKEGGMKGVKLEGGAEMASTIRKISQAGIPVMAHIGLT
PQRQHSLGGFRVQGKSAAGAVKLLRDALAVQKAGACMVLIEAVPPEIAGIITRRLSVPTIGIGSGNGCSGQVLVQ
VDMLGNFPEGRFLPKFVKTYADVWGEARRGIEAYREEVKNRAFPSVEYTYGVSKEVLEEFEKAVDEVAENEE*
Coding >Pro_DTO377G3_2|g9639.t1
ATGGGCTCAACAACCACCAGCACACGCAAAAAAGTAACAATCCAAACCATCCAAAACCTCTACAAAAAGAACGAA
CCCATCACAGTCCTTACAGCATCCGACTTCCCCAGTGGCCATGTCGCGGACACAGCCGGAATGGAGATCGTGCTC
GTAGGCGACAGCCTCGCAATGGTCGCAATGGGCATGGAAGACACAAACGAAGTAACAATGGACGAGATGCTCCTC
CACTGCCGCAGCGTAAACCGTGCTGTCAAGAGCGCCTTCACAATCGCAGACCTACCAATGGGCTCATACGAAACC
ACCCCAGAAAAGGCACTTACATCGGCAATCCGGATGGTGAAAGAAGGCGGGATGAAGGGCGTGAAACTCGAAGGC
GGGGCGGAGATGGCGTCTACGATCCGCAAGATCTCACAAGCGGGGATCCCCGTCATGGCGCACATCGGGCTAACG
CCGCAGCGGCAGCACTCGCTGGGCGGGTTCCGAGTCCAGGGCAAGTCAGCCGCGGGCGCTGTGAAACTGCTGCGG
GATGCATTGGCTGTGCAGAAAGCCGGTGCTTGTATGGTTCTTATTGAGGCTGTGCCGCCTGAGATTGCGGGTATT
ATTACGCGGCGACTGAGCGTGCCGACTATTGGGATTGGGTCTGGGAATGGGTGTTCTGGACAGGTGCTTGTGCAG
GTTGATATGTTAGGGAATTTCCCGGAGGGGAGGTTCTTGCCGAAGTTTGTTAAGACGTATGCGGATGTTTGGGGG
GAGGCGAGGAGGGGGATTGAGGCTTATAGGGAGGAGGTTAAGAATAGGGCTTTTCCTTCGGTGGAGTATACCTAT
GGTGTTTCTAAGGAGGTGTTAGAGGAGTTTGAGAAGGCTGTTGATGAGGTTGCGGAGAATGAGGAGTAA
Transcript >Pro_DTO377G3_2|g9639.t1
ATGGGCTCAACAACCACCAGCACACGCAAAAAAGTAACAATCCAAACCATCCAAAACCTCTACAAAAAGAACGAA
CCCATCACAGTCCTTACAGCATCCGACTTCCCCAGTGGCCATGTCGCGGACACAGCCGGAATGGAGATCGTGCTC
GTAGGCGACAGCCTCGCAATGGTCGCAATGGGCATGGAAGACACAAACGAAGTAACAATGGACGAGATGCTCCTC
CACTGCCGCAGCGTAAACCGTGCTGTCAAGAGCGCCTTCACAATCGCAGACCTACCAATGGGCTCATACGAAACC
ACCCCAGAAAAGGCACTTACATCGGCAATCCGGATGGTGAAAGAAGGCGGGATGAAGGGCGTGAAACTCGAAGGC
GGGGCGGAGATGGCGTCTACGATCCGCAAGATCTCACAAGCGGGGATCCCCGTCATGGCGCACATCGGGCTAACG
CCGCAGCGGCAGCACTCGCTGGGCGGGTTCCGAGTCCAGGGCAAGTCAGCCGCGGGCGCTGTGAAACTGCTGCGG
GATGCATTGGCTGTGCAGAAAGCCGGTGCTTGTATGGTTCTTATTGAGGCTGTGCCGCCTGAGATTGCGGGTATT
ATTACGCGGCGACTGAGCGTGCCGACTATTGGGATTGGGTCTGGGAATGGGTGTTCTGGACAGGTGCTTGTGCAG
GTTGATATGTTAGGGAATTTCCCGGAGGGGAGGTTCTTGCCGAAGTTTGTTAAGACGTATGCGGATGTTTGGGGG
GAGGCGAGGAGGGGGATTGAGGCTTATAGGGAGGAGGTTAAGAATAGGGCTTTTCCTTCGGTGGAGTATACCTAT
GGTGTTTCTAAGGAGGTGTTAGAGGAGTTTGAGAAGGCTGTTGATGAGGTTGCGGAGAATGAGGAGTAA
Gene >Pro_DTO377G3_2|g9639.t1
ATGGGCTCAACAACCACCAGCACACGCAAAAAAGTAACAATCCAAACCATCCAAAACCTCTACAAAAAGAACGAA
CCCATCACAGTCCTTACAGCATCCGACTTCCCCAGTGGCCATGTCGCGGACACAGCCGGAATGGAGATCGTGCTC
GTAGGCGACAGCCTCGCAATGGTCGCAATGGGCATGGAAGACACAAACGAAGTAACAATGGACGAGATGCTCCTC
CACTGCCGCAGCGTAAACCGTGCTGTCAAGAGCGCCTTCACAGTAAGTATATCCATGCATACATATACAATGCCT
ACGCCCGGCCAAGTTACCACATCTCACAACTCGCAATAGATCGCAGACCTACCAATGGGCTCATACGAAACCACC
CCAGAAAAGGCACTTACATCGGCAATCCGGATGGTGAAAGAAGGCGGGATGAAGGGCGTGAAACTCGAAGGCGGG
GCGGAGATGGCGTCTACGATCCGCAAGATCTCACAAGCGGGGATCCCCGTCATGGCGCACATCGGGCTAACGCCG
CAGCGGCAGCACTCGCTGGGCGGGTTCCGAGTCCAGGGCAAGTCAGCCGCGGGCGCTGTGAAACTGCTGCGGGAT
GCATTGGCTGTGCAGAAAGCCGGTGCTTGTATGGTTCTTATTGAGGCTGTGCCGCCTGAGATTGCGGGTATTATT
ACGCGGCGACTGAGCGTGCCGACTATTGGGATTGGGTCTGGGAATGGGTGTTCTGGACAGGTGCTTGTGCAGGTT
GATATGTTAGGGAATTTCCCGGAGGGGAGGTTCTTGCCGAAGTTTGTTAAGACGTATGCGGATGTTTGGGGGGAG
GCGAGGAGGGGGATTGAGGCTTATAGGGAGGAGGTTAAGAATAGGGCTTTTCCTTCGGTGGAGTATACCTATGGT
GTTTCTAAGGAGGTGTTAGAGGAGTTTGAGAAGGCTGTTGATGAGGTTGCGGAGAATGAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail