Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9625.t1
Gene name
Locationscaffold_54:29120..31425
Strand+
Gene length (bp)2305
Transcript length (bp)2049
Coding sequence length (bp)2049
Protein length (aa) 683

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03943 TAP_C TAP C-terminal domain 5.6E-17 630 678
PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain 1.7E-07 393 561

GO

GO Term Description Terminal node
GO:0051028 mRNA transport Yes
GO:0005634 nucleus Yes
GO:0043231 intracellular membrane-bounded organelle No
GO:0051179 localization No
GO:0015931 nucleobase-containing compound transport No
GO:0043229 intracellular organelle No
GO:0071705 nitrogen compound transport No
GO:0051234 establishment of localization No
GO:0043226 organelle No
GO:0005575 cellular_component No
GO:0050658 RNA transport No
GO:0050657 nucleic acid transport No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0043227 membrane-bounded organelle No
GO:0051236 establishment of RNA localization No
GO:0008150 biological_process No
GO:0071702 organic substance transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9625.t1
MKSMKSRRGGNDRGGIRKRGPTRTDRDGDMDMDSGSARAKRTRAEKSALGGRAAGTGVGGRATGISNRAQARTKH
RDSDLFERAVYSNNGQANVISGNKKTGGDLEQFSVRGWKSSKAASNRDGGLESLIAFLERRMNSFIKSGPRAKIT
KSRTEGDTLVAFVRPDLAGHMLRINNNVFAGAHVTVEEYTAATALDQELAAADPVPGSTADTKTKMTTILGKRFF
PATKLLDLSKLLDDPDLQAMGIFHNVSTKSKFFPALMKVWELGFKTVAERREAVESVSLAENNLSNISSVTTLAQ
SFPDIQHLDLSKNNIKNSQAMIGWRWKFRNLVFLDLTENEISSDPTFKDTMLKWYPKLQTLNNVQVRTPEEVAAQ
KKTPIPVLPPHFIDESQVGENFVRAFFPGYDNDRNSLVSSVYDDQSTFSLNVNTTAPRATQTETAGWGEYIRKSR
NLDKISHLSARMSRSFKGIEKIREVFNELPPTRHPDLIAKAEQWLIECHPVPHLPDPTGQSPTGVGGLSLMVHGQ
LEESIGGKIEIRSFDRTFILGPGNTPGGIRVVSEIFCLRAYGGHEAWSPEIQALSQIPQIAAPVPIPTAAPTPLA
VPAAVPGGNVPEGYGLPRPGKSDTQLQQEQMITQMSGKSGMTFEYSEMALAGNGWNVELAWKNFEQLKATNALPP
TAFIAPA*
Coding >Pro_DTO377G3_2|g9625.t1
ATGAAGAGCATGAAGTCCCGCCGCGGCGGCAATGATCGCGGGGGAATCCGCAAGCGGGGCCCTACTCGCACCGAC
CGGGATGGCGACATGGATATGGATTCGGGCAGTGCGCGTGCAAAGAGAACCCGTGCTGAGAAATCTGCCTTGGGT
GGCCGTGCCGCCGGCACAGGCGTAGGTGGCCGAGCTACTGGAATTAGCAACCGGGCCCAGGCTCGTACCAAGCAC
AGGGATTCGGATCTTTTTGAGAGAGCGGTTTACAGCAACAATGGCCAAGCAAACGTTATAAGTGGCAACAAGAAA
ACGGGCGGCGATCTGGAACAGTTTAGTGTCCGAGGATGGAAATCAAGCAAGGCGGCGAGCAACCGTGATGGCGGC
CTTGAGAGCCTCATTGCATTCCTTGAACGACGCATGAACTCATTCATCAAATCCGGACCTCGCGCCAAGATTACA
AAGTCGCGCACTGAAGGTGACACTCTCGTGGCCTTCGTTCGACCTGATCTGGCGGGTCACATGCTTCGAATCAAC
AACAATGTTTTCGCCGGAGCCCATGTTACTGTTGAAGAATACACCGCTGCCACCGCACTCGATCAGGAACTGGCT
GCAGCCGACCCCGTTCCTGGCTCGACCGCCGATACCAAGACTAAGATGACAACTATCCTCGGCAAGCGCTTCTTC
CCTGCTACCAAGCTACTTGACTTGTCGAAGCTGTTGGACGACCCTGATCTGCAAGCCATGGGAATCTTCCACAAC
GTCTCTACCAAGTCCAAATTCTTCCCTGCTCTCATGAAGGTCTGGGAACTGGGCTTCAAGACTGTAGCTGAACGA
CGTGAAGCGGTCGAAAGTGTCAGTCTGGCGGAAAACAACCTCAGCAACATCAGCTCTGTGACTACCCTCGCACAG
TCTTTCCCCGATATCCAACACTTGGACCTCTCAAAGAACAACATCAAAAATTCGCAGGCGATGATCGGATGGCGG
TGGAAGTTCCGCAACCTAGTTTTCCTCGACTTGACTGAAAACGAAATCAGTTCCGACCCGACTTTCAAGGACACC
ATGCTCAAGTGGTATCCCAAGCTGCAAACTTTAAATAACGTCCAAGTGCGAACTCCAGAGGAAGTCGCGGCTCAG
AAGAAGACACCGATCCCCGTCCTGCCTCCTCACTTCATTGACGAATCTCAAGTCGGCGAGAATTTCGTTCGTGCT
TTCTTCCCTGGATATGATAACGATCGTAACAGCCTCGTCAGCAGTGTCTACGATGATCAGTCCACTTTCTCGTTG
AATGTAAACACCACGGCTCCCCGGGCCACTCAAACCGAGACGGCAGGTTGGGGTGAATACATCAGAAAGAGCCGA
AATCTTGACAAGATCAGCCATCTTTCTGCACGGATGTCACGATCCTTCAAGGGCATTGAGAAAATCCGTGAAGTT
TTCAATGAGCTCCCGCCCACTCGCCACCCTGATCTTATTGCAAAGGCAGAGCAATGGCTCATTGAATGCCACCCA
GTCCCTCATCTCCCCGACCCTACTGGACAGAGCCCCACTGGCGTTGGTGGCCTTTCCCTCATGGTGCATGGACAA
CTTGAGGAGAGCATTGGTGGCAAGATTGAGATCCGAAGCTTCGACCGAACCTTTATTCTTGGCCCCGGTAACACT
CCCGGTGGCATCCGAGTTGTCAGCGAGATTTTCTGCCTACGCGCTTACGGTGGACACGAGGCATGGTCGCCTGAG
ATCCAGGCACTTTCCCAAATTCCTCAGATTGCAGCTCCCGTTCCTATTCCCACTGCGGCTCCTACACCCCTTGCA
GTCCCCGCAGCTGTCCCAGGTGGCAATGTTCCTGAGGGATACGGTTTGCCCCGACCTGGAAAATCCGACACCCAG
CTCCAGCAGGAGCAGATGATCACTCAGATGAGTGGCAAGTCGGGCATGACTTTCGAATACTCAGAGATGGCCCTC
GCGGGTAATGGCTGGAATGTCGAGCTTGCTTGGAAGAACTTCGAACAGCTCAAGGCAACCAACGCACTTCCTCCC
ACCGCTTTTATTGCTCCGGCGTGA
Transcript >Pro_DTO377G3_2|g9625.t1
ATGAAGAGCATGAAGTCCCGCCGCGGCGGCAATGATCGCGGGGGAATCCGCAAGCGGGGCCCTACTCGCACCGAC
CGGGATGGCGACATGGATATGGATTCGGGCAGTGCGCGTGCAAAGAGAACCCGTGCTGAGAAATCTGCCTTGGGT
GGCCGTGCCGCCGGCACAGGCGTAGGTGGCCGAGCTACTGGAATTAGCAACCGGGCCCAGGCTCGTACCAAGCAC
AGGGATTCGGATCTTTTTGAGAGAGCGGTTTACAGCAACAATGGCCAAGCAAACGTTATAAGTGGCAACAAGAAA
ACGGGCGGCGATCTGGAACAGTTTAGTGTCCGAGGATGGAAATCAAGCAAGGCGGCGAGCAACCGTGATGGCGGC
CTTGAGAGCCTCATTGCATTCCTTGAACGACGCATGAACTCATTCATCAAATCCGGACCTCGCGCCAAGATTACA
AAGTCGCGCACTGAAGGTGACACTCTCGTGGCCTTCGTTCGACCTGATCTGGCGGGTCACATGCTTCGAATCAAC
AACAATGTTTTCGCCGGAGCCCATGTTACTGTTGAAGAATACACCGCTGCCACCGCACTCGATCAGGAACTGGCT
GCAGCCGACCCCGTTCCTGGCTCGACCGCCGATACCAAGACTAAGATGACAACTATCCTCGGCAAGCGCTTCTTC
CCTGCTACCAAGCTACTTGACTTGTCGAAGCTGTTGGACGACCCTGATCTGCAAGCCATGGGAATCTTCCACAAC
GTCTCTACCAAGTCCAAATTCTTCCCTGCTCTCATGAAGGTCTGGGAACTGGGCTTCAAGACTGTAGCTGAACGA
CGTGAAGCGGTCGAAAGTGTCAGTCTGGCGGAAAACAACCTCAGCAACATCAGCTCTGTGACTACCCTCGCACAG
TCTTTCCCCGATATCCAACACTTGGACCTCTCAAAGAACAACATCAAAAATTCGCAGGCGATGATCGGATGGCGG
TGGAAGTTCCGCAACCTAGTTTTCCTCGACTTGACTGAAAACGAAATCAGTTCCGACCCGACTTTCAAGGACACC
ATGCTCAAGTGGTATCCCAAGCTGCAAACTTTAAATAACGTCCAAGTGCGAACTCCAGAGGAAGTCGCGGCTCAG
AAGAAGACACCGATCCCCGTCCTGCCTCCTCACTTCATTGACGAATCTCAAGTCGGCGAGAATTTCGTTCGTGCT
TTCTTCCCTGGATATGATAACGATCGTAACAGCCTCGTCAGCAGTGTCTACGATGATCAGTCCACTTTCTCGTTG
AATGTAAACACCACGGCTCCCCGGGCCACTCAAACCGAGACGGCAGGTTGGGGTGAATACATCAGAAAGAGCCGA
AATCTTGACAAGATCAGCCATCTTTCTGCACGGATGTCACGATCCTTCAAGGGCATTGAGAAAATCCGTGAAGTT
TTCAATGAGCTCCCGCCCACTCGCCACCCTGATCTTATTGCAAAGGCAGAGCAATGGCTCATTGAATGCCACCCA
GTCCCTCATCTCCCCGACCCTACTGGACAGAGCCCCACTGGCGTTGGTGGCCTTTCCCTCATGGTGCATGGACAA
CTTGAGGAGAGCATTGGTGGCAAGATTGAGATCCGAAGCTTCGACCGAACCTTTATTCTTGGCCCCGGTAACACT
CCCGGTGGCATCCGAGTTGTCAGCGAGATTTTCTGCCTACGCGCTTACGGTGGACACGAGGCATGGTCGCCTGAG
ATCCAGGCACTTTCCCAAATTCCTCAGATTGCAGCTCCCGTTCCTATTCCCACTGCGGCTCCTACACCCCTTGCA
GTCCCCGCAGCTGTCCCAGGTGGCAATGTTCCTGAGGGATACGGTTTGCCCCGACCTGGAAAATCCGACACCCAG
CTCCAGCAGGAGCAGATGATCACTCAGATGAGTGGCAAGTCGGGCATGACTTTCGAATACTCAGAGATGGCCCTC
GCGGGTAATGGCTGGAATGTCGAGCTTGCTTGGAAGAACTTCGAACAGCTCAAGGCAACCAACGCACTTCCTCCC
ACCGCTTTTATTGCTCCGGCGTGA
Gene >Pro_DTO377G3_2|g9625.t1
ATGAAGAGCATGAAGTCCCGCCGCGGCGGCAATGATCGCGGGGGAATCCGCAAGCGGGGCCCTACTCGCACCGAC
CGGGATGGCGACATGGATATGGATTCGGGCAGTGCGCGTGCAAAGAGAACCCGTGCTGAGAAATCTGCCTTGGGT
GGCCGTGCCGCCGGCACAGGCGTAGGTGGCCGAGCTACTGGAATTAGCAACCGGGCCCAGGCTCGTACCAAGCAC
AGGGATTCGGATCTTTTTGAGAGAGCGGTTTACAGCAACAATGGCCAAGCAAACGTTATAAGTGGCAACAAGAAA
ACGGGCGGCGATCTGGAACAGTTTAGTGTCCGAGGATGGAAATCAAGCAAGGCGGCGAGCAACCGTGATGGCGGC
CTTGAGAGCCTCATTGCATTCCTTGAACGACGCATGAACTCATTCATCAAATCCGGACCTCGCGCCAAGATTACA
AAGGTATGTTCCTCGTTCACAATAGCGGTCACCAACATCGATTCTCGACGTCCCCCGCTTCAGTGTCCTCTTGTT
TTCGAGGACGATCCTCCTACAAATCGACGATCGACACATTTTGGGCTTTTTGGTTTCTTTCCCTTTGGGTGACCG
TAGTTTTCAAGGTCCTTCGCACCTTTCTAACTTTCAAATTAGTCGCGCACTGAAGGTGACACTCTCGTGGCCTTC
GTTCGACCTGATCTGGCGGGTCACATGCTTCGAATCAACAACAATGTTTTCGCCGGAGCCCATGTTACTGTTGAA
GAATACACCGCTGCCACCGCACTCGATCAGGAACTGGCTGCAGCCGACCCCGTTCCTGGCTCGACCGCCGATACC
AAGACTAAGATGACAACTATCCTCGGCAAGCGCTTCTTCCCTGCTACCAAGCTACTTGACTTGTCGAAGCTGTTG
GACGACCCTGATCTGCAAGCCATGGGAATCTTCCACAACGTCTCTACCAAGTCCAAATTCTTCCCTGCTCTCATG
AAGGTCTGGGAACTGGGCTTCAAGACTGTAGCTGAACGACGTGAAGCGGTCGAAAGTGTCAGTCTGGCGGAAAAC
AACCTCAGCAACATCAGCTCTGTGACTACCCTCGCACAGTCTTTCCCCGATATCCAACACTTGGACCTCTCAAAG
AACAACATCAAAAATTCGCAGGCGATGATCGGATGGCGGTGGAAGTTCCGCAACCTAGTTTTCCTCGACTTGACT
GAAAACGAAATCAGTTCCGACCCGACTTTCAAGGACACCATGCTCAAGTGGTATCCCAAGCTGCAAACTTTAAAT
AACGTCCAAGTGCGAACTCCAGAGGAAGTCGCGGCTCAGAAGAAGACACCGATCCCCGTCCTGCCTCCTCACTTC
ATTGACGAATCTCAAGTCGGCGAGAATTTCGTTCGTGCTTTCTTCCCTGGATATGATAACGATCGTAACAGCCTC
GTCAGCAGTGTCTACGATGATCAGTCCACTTTCTCGTTGAATGTAAACACCACGGCTCCCCGGGCCACTCAAACC
GAGACGGCAGGTTGGGGTGAATACATCAGAAAGAGCCGAAATCTTGACAAGATCAGCCATCTTTCTGCACGGATG
TCACGATCCTTCAAGGGCATTGAGAAAATCCGTGAAGTTTTCAATGAGCTCCCGCCCACTCGCCACCCTGATCTT
ATTGCAAAGGCAGAGCAATGGCTCATTGAATGCCACCCAGTCCCTCATCTCCCCGACCCTACTGGACAGAGCCCC
ACTGGCGTTGGTGGCCTTTCCCTCATGGTGCATGGACAACTTGAGGAGAGCATTGGTGGCAAGATTGAGATCCGA
AGCTTCGACCGAACCTTTATTCTTGGCCCCGGTAACACTCCCGGTGGCATCCGAGTTGTCAGCGAGATTTTCTGC
CTACGCGCTTACGGTGGACACGAGGCATGGTCGCCTGAGATCCAGGCACTTTCCCAAATTCCTCAGATTGCAGCT
CCCGTTCCTATTCCCACTGCGGCTCCTACACCCCTTGCAGTCCCCGCAGCTGTCCCAGGTGGCAATGTTCCTGAG
GGATACGGTTTGCCCCGACCTGGAAAATCCGACACCCAGCTCCAGCAGGAGCAGATGATCACTCAGATGAGTGGC
AAGTCGGGCATGACTTTCGAATACTCAGAGATGGCCCTCGCGGGTAATGGCTGGAATGTCGAGCTTGCTTGGAAG
AACTTCGAACAGCTCAAGGTAAGCTAATTCCGAGGATGGCTCCCTGATTTACCAAGGAATGATAACTAACGAAGC
TCTACAACAGGCAACCAACGCACTTCCTCCCACCGCTTTTATTGCTCCGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail