Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9601.t1
Gene name
Locationscaffold_52:66663..68483
Strand+
Gene length (bp)1820
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 219 241 22
2 328 350 22
3 371 393 22
4 408 427 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9601.t1
MKVSGSMEPALRRRHGRDNVRIFKPLLRAYALGYLSSVTPKLLSYVRRLRNNDWTAQQKLQELAKVLASPLRLNS
FPTACASLVGGSTLLPIGLYRLCALITAGLSKRDVRISQRLDRLIRFIISLLSGWFSFQLLNKNRICLPVEDVRT
IRNSTDQGEDSSQLMANSLEHHRPELAGRTMDLTIYMVTRAVDALACVAWGRWSRRRRAQNRWTTVESLVPGFAD
ATVFAMSAAVVMWAWFYLPERLPRAYEKWIGEAAQVDSRLIEALRRARRGVFVYGKDTGQAPLLQSMCNDYNWPE
VWGDPSKFVPIPCEMVHMGCGPSCEKHALYRFARTFKYACATYIPLQIIFRLRRMKSANALRRALSDAARSSAFL
ASFVSLFYYGVCLARTRLGPKVFDAKTVTPMMWDSGLCVGAGCLMCGWSILVEKTRKRQELALFVAPRAAATVLP
RLYEKKYQYRERIAFAVSAAVLITCLRERPSMVRGVFGRITSSVLN*
Coding >Pro_DTO377G3_2|g9601.t1
ATGAAGGTTTCCGGCAGCATGGAACCTGCACTCCGGAGACGCCATGGAAGGGACAACGTCCGGATATTCAAGCCC
CTCCTTCGCGCATATGCACTCGGGTACCTATCTTCTGTCACCCCGAAATTGTTGTCTTATGTCCGCCGACTGCGC
AATAACGATTGGACTGCGCAACAGAAACTTCAAGAGTTAGCTAAAGTCTTGGCTAGTCCTTTACGTCTGAACAGT
TTCCCAACAGCTTGTGCTTCCCTGGTCGGTGGCTCAACCCTACTACCAATAGGATTATATCGTCTGTGTGCATTG
ATCACGGCAGGTCTGTCCAAGCGTGACGTTCGGATCTCACAAAGGCTGGACCGCTTAATTAGATTCATCATCTCT
CTTCTATCTGGATGGTTCAGTTTTCAACTGCTCAACAAGAACCGCATCTGTCTGCCAGTAGAAGATGTTAGAACT
ATCCGGAACTCCACAGATCAGGGGGAAGACTCCAGTCAGCTTATGGCCAATTCGCTGGAACATCACCGCCCAGAG
TTAGCAGGGAGGACAATGGACCTCACCATCTACATGGTCACAAGAGCCGTAGATGCGCTCGCATGTGTTGCATGG
GGTCGCTGGTCCCGTCGCCGCCGAGCCCAGAATCGCTGGACGACTGTCGAATCCCTTGTCCCTGGCTTCGCCGAC
GCAACTGTCTTTGCCATGAGTGCGGCTGTGGTCATGTGGGCGTGGTTTTATCTCCCCGAAAGACTGCCCAGAGCC
TATGAGAAGTGGATCGGGGAAGCTGCTCAGGTCGACTCACGTTTAATTGAAGCCTTGCGCCGTGCTCGACGAGGA
GTTTTCGTCTATGGAAAGGATACAGGCCAGGCACCTCTTCTCCAGTCGATGTGCAATGATTACAACTGGCCAGAG
GTATGGGGTGACCCATCAAAATTTGTCCCGATCCCTTGCGAAATGGTTCACATGGGCTGTGGCCCCAGCTGTGAA
AAACACGCATTGTATCGATTTGCCAGAACCTTCAAATATGCCTGTGCAACCTATATACCCCTACAGATTATTTTC
CGCCTGCGCAGGATGAAATCTGCAAATGCCCTTCGTCGGGCCCTTTCTGATGCAGCACGCTCATCTGCCTTCCTC
GCATCTTTTGTGAGCTTATTTTACTACGGTGTCTGTCTCGCTCGGACACGACTCGGCCCCAAGGTCTTTGACGCG
AAGACGGTCACTCCGATGATGTGGGACTCTGGGCTATGTGTCGGTGCGGGATGTCTCATGTGCGGCTGGAGTATA
TTGGTTGAAAAGACGCGGAAGAGGCAGGAGTTGGCGCTATTTGTGGCACCCCGGGCTGCCGCCACGGTTTTGCCA
CGGTTGTATGAGAAAAAGTATCAATACCGAGAGCGCATCGCATTTGCTGTTAGCGCTGCTGTTCTTATCACTTGC
CTCCGTGAGCGACCTAGCATGGTACGAGGGGTGTTTGGTCGCATCACGTCGAGTGTGTTGAATTAG
Transcript >Pro_DTO377G3_2|g9601.t1
ATGAAGGTTTCCGGCAGCATGGAACCTGCACTCCGGAGACGCCATGGAAGGGACAACGTCCGGATATTCAAGCCC
CTCCTTCGCGCATATGCACTCGGGTACCTATCTTCTGTCACCCCGAAATTGTTGTCTTATGTCCGCCGACTGCGC
AATAACGATTGGACTGCGCAACAGAAACTTCAAGAGTTAGCTAAAGTCTTGGCTAGTCCTTTACGTCTGAACAGT
TTCCCAACAGCTTGTGCTTCCCTGGTCGGTGGCTCAACCCTACTACCAATAGGATTATATCGTCTGTGTGCATTG
ATCACGGCAGGTCTGTCCAAGCGTGACGTTCGGATCTCACAAAGGCTGGACCGCTTAATTAGATTCATCATCTCT
CTTCTATCTGGATGGTTCAGTTTTCAACTGCTCAACAAGAACCGCATCTGTCTGCCAGTAGAAGATGTTAGAACT
ATCCGGAACTCCACAGATCAGGGGGAAGACTCCAGTCAGCTTATGGCCAATTCGCTGGAACATCACCGCCCAGAG
TTAGCAGGGAGGACAATGGACCTCACCATCTACATGGTCACAAGAGCCGTAGATGCGCTCGCATGTGTTGCATGG
GGTCGCTGGTCCCGTCGCCGCCGAGCCCAGAATCGCTGGACGACTGTCGAATCCCTTGTCCCTGGCTTCGCCGAC
GCAACTGTCTTTGCCATGAGTGCGGCTGTGGTCATGTGGGCGTGGTTTTATCTCCCCGAAAGACTGCCCAGAGCC
TATGAGAAGTGGATCGGGGAAGCTGCTCAGGTCGACTCACGTTTAATTGAAGCCTTGCGCCGTGCTCGACGAGGA
GTTTTCGTCTATGGAAAGGATACAGGCCAGGCACCTCTTCTCCAGTCGATGTGCAATGATTACAACTGGCCAGAG
GTATGGGGTGACCCATCAAAATTTGTCCCGATCCCTTGCGAAATGGTTCACATGGGCTGTGGCCCCAGCTGTGAA
AAACACGCATTGTATCGATTTGCCAGAACCTTCAAATATGCCTGTGCAACCTATATACCCCTACAGATTATTTTC
CGCCTGCGCAGGATGAAATCTGCAAATGCCCTTCGTCGGGCCCTTTCTGATGCAGCACGCTCATCTGCCTTCCTC
GCATCTTTTGTGAGCTTATTTTACTACGGTGTCTGTCTCGCTCGGACACGACTCGGCCCCAAGGTCTTTGACGCG
AAGACGGTCACTCCGATGATGTGGGACTCTGGGCTATGTGTCGGTGCGGGATGTCTCATGTGCGGCTGGAGTATA
TTGGTTGAAAAGACGCGGAAGAGGCAGGAGTTGGCGCTATTTGTGGCACCCCGGGCTGCCGCCACGGTTTTGCCA
CGGTTGTATGAGAAAAAGTATCAATACCGAGAGCGCATCGCATTTGCTGTTAGCGCTGCTGTTCTTATCACTTGC
CTCCGTGAGCGACCTAGCATGGTACGAGGGGTGTTTGGTCGCATCACGTCGAGTGTGTTGAATTAG
Gene >Pro_DTO377G3_2|g9601.t1
ATGAAGGTTTCCGGCAGCATGGAACCTGCACTCCGGAGACGCCATGGAAGGGACAACGTCCGGATATTCAAGCCG
TGAGTCCATGCGATCTGTTACCCTTGTGGCTTGGTGCAACTGTGTGATCTGAAGAGCCCTTGCTGATTACGACTG
TAGCCTCCTTCGCGCATATGCACTCGGGTACCTATCTTCTGTCACCCCGAAATTGTTGTCTTATGTCCGCCGACT
GCGCAATAACGATTGGACTGCGCAACAGAAACTTCAAGAGGTACGTCGTAGTATTACCTAGTATGGGGCTCTTAT
CGCGACTTATCTTGTCACCCTTGCCTCTAGTCTATTGTACAAACGGAATGCTATAGCTGACCTCACCTCGAATAG
TTAGCTAAAGTCTTGGCTAGTCCTTTACGTCTGAACAGTTTCCCAACAGCTTGTGCTTCCCTGGTCGGTGGCTCA
ACCCTACTACCAATAGGATTATATCGTCTGTGTGCATTGATCACGGCAGGTCTGTCCAAGCGTGACGTTCGGATC
TCACAAAGGCTGGACCGCTTAATTAGATTCATCATCTCTCTTCTATCTGGATGGTTCAGTTTTCAACTGCTCAAC
AAGAACCGCATCTGTCTGCCAGTAGAAGATGTTAGAACTATCCGGAACTCCACAGATCAGGGGGAAGACTCCAGT
CAGCTTATGGCCAATTCGCTGGAACATCACCGCCCAGAGTTAGCAGGGAGGACAATGGACCTCACCATCTACATG
GTCACAAGAGCCGTAGATGCGCTCGCATGTGTTGCATGGGGTCGCTGGTCCCGTCGCCGCCGAGCCCAGAATCGC
TGGACGACTGTCGAATCCCTTGTCCCTGGCTTCGCCGACGCAACTGTCTTTGCCATGAGTGCGGCTGTGGTCATG
TGGGCGTGGTTTTATCTCCCCGAAAGACTGCCCAGAGCCTATGAGAAGTGGATCGGGGAAGCTGCTCAGGTCGAC
TCACGTTTAATTGAAGCCTTGCGCCGTGCTCGACGAGGAGTTTTCGTCTATGGAAAGGATACAGGCCAGGCACCT
CTTCTCCAGTCGATGTGCAATGATTACAACTGGCCAGAGGTATGGGGTGACCCATCAAAATTTGTCCCGATCCCT
TGCGAAATGGTTCACATGGGCTGTGGCCCCAGCTGTGAAAAACACGCATTGTATCGATTTGCCAGAACCTTCAAA
TATGCCTGTGCAACCTATATACCCCTACAGATTATTTTCCGCCTGCGCAGGATGAAATCTGCAAATGCCCTTCGT
CGGGCCCTTTCTGATGCAGCACGCTCATCTGCCTTCCTCGCATCTTTTGTGAGCTTATTTTACTACGGTGTCTGT
CTCGCTCGGACACGACTCGGCCCCAAGGTCTTTGACGCGAAGACGGTCACTCCGATGATGTGGGACTCTGGGCTA
TGTGTCGGTGCGGGATGTCTCATGTGCGGCTGGAGTATATTGGTTGAAAAGACGCGGAAGAGGCAGGAGTTGGCG
CTATTTGTGGCACCCCGGGCTGCCGCCACGGTTTTGCCACGGTTGTATGAGAAAAAGGTATGTATCGGACCCTCG
CATCATCTGTTCACAACAGGGTTACACCCACATCCCCTCCAACTCCTTCTTAATGTCTTCGAATTAACCTGTGGC
ATGTTCCAAAACAATCACGAGATGCTGACGCGTGTTGTGTTTCCCAGTATCAATACCGAGAGCGCATCGCATTTG
CTGTTAGCGCTGCTGTTCTTATCACTTGCCTCCGTGAGCGACCTAGCATGGTACGAGGGGTGTTTGGTCGCATCA
CGTCGAGTGTGTTGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail