Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9597.t1
Gene name
Locationscaffold_52:55505..59346
Strand-
Gene length (bp)3841
Transcript length (bp)2883
Coding sequence length (bp)2883
Protein length (aa) 961

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08631 SPO22 Meiosis protein SPO22/ZIP4 like 2.3E-30 174 437

GO

GO Term Description Terminal node
GO:0051321 meiotic cell cycle Yes
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0022414 reproductive process No
GO:0007049 cell cycle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9597.t1
MAQPSRLHPALAGHAHTLHIALSTVGTSSPLLPPNAISRLDRWLKRNPFVVMANTSSRQQLDMVGTLLWNDCTHL
ISLRGQNPEDMLILGKVRAFAFVVLNMAVMPDLLGDLRALDLAVKAARICIVNQQSEIAVNILSVAATRLSNIQP
AHLGLDAAINRTITTQYLLLRMRLAWLHERADIAEHFYGKLPVLHRSHDEEWIFETCFIIGDSALARRLPDIAIT
WLQRASDHLQSLHMMIKFPYYYDWDLVIRHSLVVACSQVKIPLATAIYDFEMSYLRENYPFHPAVILFDLSMGHG
NPSNDGALQALERLVDGMTLTDMNMPIIFQYARSLGHIGGSDDGMEALRRLLMRPLPAGEWTEKCFVAFLLLLSR
SDLSDSTRIQALQDVIDSLERRGYPSFSSRASHATLICIWKMTAGAISRNDRWSARLWLQLCSQPKIFQRCSLPI
QIVIQKKLVAYYIEAGQLADARWLIDRGIVQSQEDCQRMYLSYKLTLLEGKSGAAHFYLGFPSHPVPHKQLSLLS
CAMEAQRQHKPEEVLNCLEPFINCLTSDDIYHHDFPAAEHHMFAITLLSEELSKGGFNQRLGKCIETVLESALSY
AKENSLFEGGDREVSVTQLEWLYLATYNVALKLINSSGFLSATHALDHSRDFALQYRQIEYPEGGSKAPRPHLFS
VIYLRLLVSTLRARCADPTAKKPHYEDVCICFQQLGDLRGWEDGEETDAGANYKEEKHYNIARFFNLEATMHLNR
WQDVVRICASDDTIPDSKFYPQIMDLTLRLNLPPTWAIWLIKRIVSKLNELRDDPPTTWQHDFRASLPRYLHCLF
ILAIEPDPYASTDRSANLGFKMADAEVAEEVLDKILAMADEEAAVAEERYGTQHSLNAIQVGSEMDYMFTYPAGE
LINVATMSFNKAIDFYRATRDQDCQRWAEKAIRVAQLVPGAQGKALVNVLQIRLGSLIGV*
Coding >Pro_DTO377G3_2|g9597.t1
ATGGCGCAACCGTCTAGACTACACCCGGCTCTAGCTGGTCATGCTCACACTTTGCATATAGCCTTATCTACAGTC
GGAACCTCGAGTCCTCTCCTTCCTCCCAATGCCATTTCCAGACTGGATAGATGGCTCAAGCGTAACCCGTTTGTT
GTCATGGCAAATACATCGAGTCGCCAGCAGCTGGATATGGTTGGAACATTACTCTGGAATGACTGCACCCATCTG
ATCAGCTTGCGTGGTCAAAATCCGGAGGATATGCTGATTCTCGGCAAAGTGAGGGCTTTCGCGTTTGTTGTGTTG
AACATGGCTGTCATGCCTGACCTCCTAGGAGACCTCCGGGCTCTCGATCTGGCCGTCAAGGCTGCGCGTATTTGC
ATTGTGAACCAGCAAAGCGAAATTGCGGTAAATATCTTGTCAGTGGCAGCCACGAGGTTGTCAAACATTCAGCCT
GCTCATCTCGGGCTTGACGCTGCGATTAACCGCACTATCACCACCCAATACTTGTTGCTCCGTATGCGACTGGCC
TGGTTGCATGAACGAGCAGATATCGCCGAGCATTTTTATGGCAAACTCCCTGTCTTGCATAGGTCGCATGATGAA
GAGTGGATTTTCGAGACTTGCTTTATCATTGGTGACTCTGCACTCGCACGGCGCCTGCCTGACATCGCTATCACA
TGGCTGCAGAGAGCGAGCGATCACTTGCAGTCCTTACACATGATGATTAAGTTTCCATATTATTATGATTGGGAC
TTGGTTATTCGACATTCTCTTGTTGTGGCTTGTTCACAAGTCAAAATCCCTCTGGCAACCGCCATCTACGATTTT
GAAATGAGCTACTTGAGAGAAAATTACCCATTTCACCCTGCTGTGATCCTTTTTGATCTATCTATGGGACATGGC
AATCCTAGTAATGACGGGGCACTACAAGCCCTAGAGAGGCTGGTTGATGGCATGACCCTTACAGATATGAACATG
CCGATAATTTTCCAATATGCCCGATCTCTGGGTCATATAGGTGGTTCGGATGACGGAATGGAAGCACTTCGAAGG
CTGCTCATGCGCCCTCTGCCAGCAGGAGAATGGACAGAGAAATGCTTTGTTGCTTTTCTTCTACTTTTGAGCAGA
TCGGACTTGTCTGATTCTACGCGTATTCAGGCCCTCCAGGATGTGATTGACTCACTAGAGCGACGTGGATATCCA
TCTTTTAGCAGTAGGGCATCTCACGCCACATTGATTTGCATCTGGAAAATGACTGCTGGTGCAATTTCCCGGAAT
GACCGCTGGAGTGCAAGGCTATGGCTTCAGTTGTGCAGTCAGCCAAAGATCTTCCAACGCTGCTCCCTGCCCATC
CAGATTGTGATACAAAAGAAGCTGGTTGCTTATTACATAGAGGCTGGACAGCTTGCCGACGCTCGTTGGTTAATC
GATCGGGGTATAGTCCAAAGCCAGGAAGATTGCCAAAGGATGTACTTGTCTTACAAGTTGACATTGCTGGAGGGA
AAAAGCGGTGCTGCGCATTTCTATCTCGGCTTTCCTTCGCATCCCGTGCCGCACAAGCAACTGAGCCTTCTTTCG
TGCGCAATGGAAGCTCAGAGACAACACAAACCAGAAGAAGTCCTGAATTGTCTTGAACCATTTATCAACTGTTTG
ACTTCAGATGACATTTATCATCATGACTTTCCCGCCGCCGAACATCACATGTTTGCCATTACTCTTCTCTCCGAA
GAGCTATCCAAGGGTGGCTTTAACCAGAGACTTGGCAAATGCATCGAGACTGTACTCGAAAGTGCCCTGTCTTAT
GCCAAAGAAAACAGCCTGTTTGAAGGTGGCGATCGGGAGGTCTCAGTCACTCAACTGGAATGGCTGTATTTGGCA
ACTTACAACGTTGCTCTGAAACTTATCAACTCTTCCGGATTCCTGTCGGCTACGCATGCCTTAGATCACTCCAGA
GATTTTGCGCTCCAGTATCGTCAGATTGAATACCCTGAGGGGGGCTCCAAAGCACCCCGGCCGCATTTGTTTTCG
GTTATTTACCTTCGTCTCCTTGTTAGCACACTTAGGGCCCGCTGTGCTGATCCGACTGCAAAGAAACCGCACTAC
GAGGATGTATGCATTTGTTTTCAACAACTAGGTGACTTGCGTGGTTGGGAAGATGGAGAAGAGACAGACGCTGGC
GCAAATTACAAAGAAGAAAAGCACTATAATATTGCCCGATTTTTCAACCTTGAGGCTACCATGCACCTCAACAGG
TGGCAGGATGTTGTCAGGATATGTGCATCCGATGACACGATCCCTGATTCAAAGTTTTACCCACAGATCATGGAT
TTGACTCTCCGATTGAACCTACCACCCACATGGGCGATCTGGCTTATCAAGCGGATCGTGTCGAAACTCAACGAG
CTACGGGACGATCCCCCTACCACATGGCAACACGATTTCCGAGCCTCCCTGCCTCGTTACCTCCACTGTCTATTC
ATACTAGCCATTGAACCGGACCCCTACGCAAGCACTGATAGAAGTGCCAATCTTGGTTTCAAAATGGCCGATGCT
GAAGTTGCTGAAGAAGTGCTCGATAAAATCCTCGCAATGGCAGACGAAGAGGCAGCCGTTGCAGAGGAAAGATAC
GGTACACAGCACAGCCTCAATGCCATCCAGGTCGGGTCGGAGATGGATTATATGTTTACATATCCAGCGGGGGAA
TTAATCAATGTTGCTACCATGTCCTTCAACAAGGCTATTGACTTTTACCGTGCTACGCGGGACCAGGATTGTCAG
CGTTGGGCGGAAAAAGCCATTCGTGTTGCCCAGCTTGTGCCTGGTGCTCAGGGCAAAGCGCTGGTCAACGTACTT
CAGATCAGACTGGGAAGCTTGATTGGAGTTTGA
Transcript >Pro_DTO377G3_2|g9597.t1
ATGGCGCAACCGTCTAGACTACACCCGGCTCTAGCTGGTCATGCTCACACTTTGCATATAGCCTTATCTACAGTC
GGAACCTCGAGTCCTCTCCTTCCTCCCAATGCCATTTCCAGACTGGATAGATGGCTCAAGCGTAACCCGTTTGTT
GTCATGGCAAATACATCGAGTCGCCAGCAGCTGGATATGGTTGGAACATTACTCTGGAATGACTGCACCCATCTG
ATCAGCTTGCGTGGTCAAAATCCGGAGGATATGCTGATTCTCGGCAAAGTGAGGGCTTTCGCGTTTGTTGTGTTG
AACATGGCTGTCATGCCTGACCTCCTAGGAGACCTCCGGGCTCTCGATCTGGCCGTCAAGGCTGCGCGTATTTGC
ATTGTGAACCAGCAAAGCGAAATTGCGGTAAATATCTTGTCAGTGGCAGCCACGAGGTTGTCAAACATTCAGCCT
GCTCATCTCGGGCTTGACGCTGCGATTAACCGCACTATCACCACCCAATACTTGTTGCTCCGTATGCGACTGGCC
TGGTTGCATGAACGAGCAGATATCGCCGAGCATTTTTATGGCAAACTCCCTGTCTTGCATAGGTCGCATGATGAA
GAGTGGATTTTCGAGACTTGCTTTATCATTGGTGACTCTGCACTCGCACGGCGCCTGCCTGACATCGCTATCACA
TGGCTGCAGAGAGCGAGCGATCACTTGCAGTCCTTACACATGATGATTAAGTTTCCATATTATTATGATTGGGAC
TTGGTTATTCGACATTCTCTTGTTGTGGCTTGTTCACAAGTCAAAATCCCTCTGGCAACCGCCATCTACGATTTT
GAAATGAGCTACTTGAGAGAAAATTACCCATTTCACCCTGCTGTGATCCTTTTTGATCTATCTATGGGACATGGC
AATCCTAGTAATGACGGGGCACTACAAGCCCTAGAGAGGCTGGTTGATGGCATGACCCTTACAGATATGAACATG
CCGATAATTTTCCAATATGCCCGATCTCTGGGTCATATAGGTGGTTCGGATGACGGAATGGAAGCACTTCGAAGG
CTGCTCATGCGCCCTCTGCCAGCAGGAGAATGGACAGAGAAATGCTTTGTTGCTTTTCTTCTACTTTTGAGCAGA
TCGGACTTGTCTGATTCTACGCGTATTCAGGCCCTCCAGGATGTGATTGACTCACTAGAGCGACGTGGATATCCA
TCTTTTAGCAGTAGGGCATCTCACGCCACATTGATTTGCATCTGGAAAATGACTGCTGGTGCAATTTCCCGGAAT
GACCGCTGGAGTGCAAGGCTATGGCTTCAGTTGTGCAGTCAGCCAAAGATCTTCCAACGCTGCTCCCTGCCCATC
CAGATTGTGATACAAAAGAAGCTGGTTGCTTATTACATAGAGGCTGGACAGCTTGCCGACGCTCGTTGGTTAATC
GATCGGGGTATAGTCCAAAGCCAGGAAGATTGCCAAAGGATGTACTTGTCTTACAAGTTGACATTGCTGGAGGGA
AAAAGCGGTGCTGCGCATTTCTATCTCGGCTTTCCTTCGCATCCCGTGCCGCACAAGCAACTGAGCCTTCTTTCG
TGCGCAATGGAAGCTCAGAGACAACACAAACCAGAAGAAGTCCTGAATTGTCTTGAACCATTTATCAACTGTTTG
ACTTCAGATGACATTTATCATCATGACTTTCCCGCCGCCGAACATCACATGTTTGCCATTACTCTTCTCTCCGAA
GAGCTATCCAAGGGTGGCTTTAACCAGAGACTTGGCAAATGCATCGAGACTGTACTCGAAAGTGCCCTGTCTTAT
GCCAAAGAAAACAGCCTGTTTGAAGGTGGCGATCGGGAGGTCTCAGTCACTCAACTGGAATGGCTGTATTTGGCA
ACTTACAACGTTGCTCTGAAACTTATCAACTCTTCCGGATTCCTGTCGGCTACGCATGCCTTAGATCACTCCAGA
GATTTTGCGCTCCAGTATCGTCAGATTGAATACCCTGAGGGGGGCTCCAAAGCACCCCGGCCGCATTTGTTTTCG
GTTATTTACCTTCGTCTCCTTGTTAGCACACTTAGGGCCCGCTGTGCTGATCCGACTGCAAAGAAACCGCACTAC
GAGGATGTATGCATTTGTTTTCAACAACTAGGTGACTTGCGTGGTTGGGAAGATGGAGAAGAGACAGACGCTGGC
GCAAATTACAAAGAAGAAAAGCACTATAATATTGCCCGATTTTTCAACCTTGAGGCTACCATGCACCTCAACAGG
TGGCAGGATGTTGTCAGGATATGTGCATCCGATGACACGATCCCTGATTCAAAGTTTTACCCACAGATCATGGAT
TTGACTCTCCGATTGAACCTACCACCCACATGGGCGATCTGGCTTATCAAGCGGATCGTGTCGAAACTCAACGAG
CTACGGGACGATCCCCCTACCACATGGCAACACGATTTCCGAGCCTCCCTGCCTCGTTACCTCCACTGTCTATTC
ATACTAGCCATTGAACCGGACCCCTACGCAAGCACTGATAGAAGTGCCAATCTTGGTTTCAAAATGGCCGATGCT
GAAGTTGCTGAAGAAGTGCTCGATAAAATCCTCGCAATGGCAGACGAAGAGGCAGCCGTTGCAGAGGAAAGATAC
GGTACACAGCACAGCCTCAATGCCATCCAGGTCGGGTCGGAGATGGATTATATGTTTACATATCCAGCGGGGGAA
TTAATCAATGTTGCTACCATGTCCTTCAACAAGGCTATTGACTTTTACCGTGCTACGCGGGACCAGGATTGTCAG
CGTTGGGCGGAAAAAGCCATTCGTGTTGCCCAGCTTGTGCCTGGTGCTCAGGGCAAAGCGCTGGTCAACGTACTT
CAGATCAGACTGGGAAGCTTGATTGGAGTTTGA
Gene >Pro_DTO377G3_2|g9597.t1
ATGGCGCAACCGTCTAGACTACACCCGGCTCTAGCTGGTACGAGCCACACATCATGTCCCCGCTATGCGCAGCAG
CTGACCCCCATATTCTTCTATCTAGGTCATGCTCACACTTTGCATATAGCCTTATCTACAGTCGGAACCTCGAGT
CCTCTCCTTCCTCCCAATGCCATTTCCAGACTGGATAGATGGCTCAAGCGTAACCCGTTTGTTGTCATGGCAAAT
ACATCGAGTCGCCAGCAGCTGGATATGGTTGGAACATTACTCTGGAATGACTGCACCCATCTGATCAGCTTGCGT
GGTCAAAATCCGGAGGATATGCTGATTCTCGGCAAAGTGAGGGCTTTCGCGTTTGTTGTGTTGAACATGGCTGTC
ATGCCTGACCTCCTAGGTTTTTAATGGCCTCTAATATATGTTGAAGTGACCTTATCTAACCTCTTACAGGAGACC
TCCGGGCTCTCGATCTGGCCGTCAAGGCTGCGCGTATTTGCATTGGTATACCATCTTACATCTCACTTGATGACT
TGATCAGGTCTAACGACAAGAACAGTGAACCAGCAAAGCGAAATTGCGGTAAATATCTTGTCAGTGGCAGCCACG
AGGTTGTCAAACATTCAGCCTGCTCATCTCGGGCTTGACGCTGCGATTAACCGCACTATCACCACCCAATACTTG
TTGCTCCGTATGCGACTGGTGAGTTGCATTGCTTGAACACTGCTTTGTGTGTCAACACCAGAATTGACATTATTT
CAGGCCTGGTTGCATGAACGAGCAGATATCGCCGAGCATTTTTATGGCAAACTCCCTGTCTTGCATAGGTCGCAT
GATGAAGAGTGGATTTTCGAGACTTGCTTTATCATTGGTGACTCTGCACTCGCACGGCGCCTGCCTGACATCGCT
ATCACATGGCTGCAGAGAGCGAGCGATCACTTGCAGTCCTTACACATGATGATTAAGTTTCCATATTATTATGAT
TGGGACTTGGTTATTCGACATTCTCTTGGTGGGTGGGTTGATCTAGTTGATGACCCGGACTAACATGCTGCAGTT
GTGGCTTGTTCACAAGTCAAAATCCCTCTGGCAACCGCCATCTACGATTTTGAAATGAGCTACTTGAGAGAAGTA
CGTTTGTGGTGAATGTGGTAGACTTGAAGCTGACCTTTTTAGAATTACCCATTTCACCCTGCTGTGATCCTTTTT
GATCTATCTATGGGACATGGCAATCCTAGTAATGACGGGGCACTACAAGGTAAGACTGATCTTTATCTTGAATGG
AATTGAATTAACAATATTGTTGTAGCCCTAGAGAGGCTGGTTGATGGCATGACCCTTACAGATATGAACATGCCG
ATGTGAGTTATCCCAATTATTTACTGTAATTTTTGATAAATGTTAACTGTTGATCCAGAATTTTCCAATATGCCC
GATCTCTGGGTCATATAGGGTACCTTGATACACCTATCGGTGAGAGACTTTGCTGACAGTTCTTTAGTGGTTCGG
ATGACGGAATGGAAGCACTTCGAAGGCTGCTCATGCGCCCTCTGCCAGCAGGAGAATGGACAGAGAAATGCTTTG
TTGCTTTTCTTCTACTTTTGAGCAGATCGGACTTGTCTGATTCTACGCGTATTCAGGCCCTCCAGGATGTGATTG
ACTCACTAGAGCGACGTGGATATCCATCTTTTAGCAGTAGGGCATCTCACGCCACATTGATTGTAAGGCATACTC
AAACTCTCATCATCTTCAATTCAAGGAGCTGACTATTATATACAGTGCATCTGGAAAATGACTGCTGGTGCAATT
TCCCGGAATGACCGCTGGAGTGCAAGGCTATGGCTTCAGTTGTGCAGTCAGCCAAAGATCTTCCAACGCTGCTCC
CTGCCCATCCAGATTGTGATACAAAAGTTAGTGGAACAAGAATTGAGATTTAACTAGCACTGTGAGCTGACATAT
TTCAGGAAGCTGGTTGCTTATTACATAGAGGCTGGACAGCTTGCCGACGCTCGTTGGTTAATCGATCGGGGTATA
GTCCAAAGCCAGGAAGATTGCCAAAGGATGTACTTGTCTTACAAGTTGACATTGCTGGAGGGAAAAAGCGGTGCT
GGTACGAATATTCTATCGGAAACCAACGCTTCTGGCCTATTCTAACTATATGCAAGCGCATTTCTATCTCGGCTT
TCCTTCGCATCCCGTGCCGCACAAGCAACTGAGCCTTCTTTCGTGCGCAATGGAAGCTCAGAGACAACACAAACC
AGAAGAAGTCCTGAATTGTCTTGAACCATTTATCAACTGTTTGACTTCAGATGACATTTATCATCATGACTTTCC
CGCCGCCGAACATCACATGTGAGAATGTTTCATATTTTTGACTCGCTATGCAAGGCTAACTTGCCTACTATGAAT
AGGTTTGCCATTACTCTTCTCTCCGAAGAGCTATCCAAGGGTGGCTTTAACCAGAGACTTGGCAAATGCATCGAG
ACTGTACTCGAAAGTGGTGCGTTTTCCCCCAGGCAATAGTAATTTGTGATGCTAATCGTTCAATAGCCCTGTCTT
ATGCCAAAGAAAACAGCCTGTTTGAAGGTGGCGATCGGGAGGTCTCAGTCACTCAACTGGAATGGCTGTATTTGG
CAACTTACAACGTTGCTCTGAAACTTATCAACTCTTCCGGATTCCTGTCGGCTACGCATGCCTTAGATCACTCCA
GAGATGTCTGTTTCGACCAGGCAAAGTTTTTGCTTGGCTATGTTTTACTAACATCTTTTCAGTTTGCGCTCCAGT
ATCGTCAGATTGAATACCCTGAGGGGGGCTCCAAAGCACCCCGGCCGCATTTGTTTTCGGTTATTTACCTTCGTC
TCCTTGTTAGCACACTTAGGGCCCGCTGTGCTGATCCGACTGCAAAGGTTAGTTACATCAATTCTTGTCTACAAC
ATATTATCCCCCGAAAATGTTGCAACGTTATAGTCCCATAATACTAATTGTCTGCAGAAACCGCACTACGAGGAT
GTATGCATTTGTTTTCAACAACTAGGTGACTTGCGTGGTTGGGAAGATGGAGAAGAGACAGACGCTGGCGCAAAT
TACAAAGAAGAAAAGCACTATAATATTGCCCGATTTTTCAACCTTGAGGCTACCATGCACCTCAACAGGTGGCAG
GATGTTGTCAGGATATGTGCATCCGATGACACGATCCCTGATTCAAAGTTTTACCCACAGATCATGGATTTGACT
CTCCGATTGAACCTACCACCCACATGGGCGATCTGGCTTATCAAGGTTCGTTGTTTCTTTATTACCGGGAGACTA
CATTCTTTGAAAAATACTCACATCTATACAATAGCGGATCGTGTCGAAACTCAACGAGCTACGGGACGATCCCCC
TACCACATGGCAACACGATTTCCGAGCCTCCCTGCCTCGTTACCTCCACTGTCTATTCATACTAGCCATTGAACC
GGACCCCTACGCAAGCACTGATAGAAGTGCCAATCTTGGTTTCAAAATGGCCGATGCTGAAGTTGCTGAAGAAGT
GCTCGATAAAATCCTCGCAATGGCAGACGAAGAGGCAGCCGTTGCAGAGGAAAGATACGGTACACAGCACAGCCT
CAATGCCATCCAGGTCGGGTCGGAGATGGATTATATGTTTACATATCCAGCGGGGGAATTAATCAATGTTGCTAC
CATGTCCTTCAACAAGGCTATTGACTTTTACCGTGCTACGCGGGACCAGGATTGTCAGCGTTGGGCGGAAAAAGC
CATTCGTGTTGCCCAGCTTGTGCCTGGTGCTCAGGGCAAAGCGCTGGTCAACGTACTTCAGATCAGACTGGGAAG
CTTGATTGGAGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail