Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9592.t1
Gene name
Locationscaffold_52:41701..42695
Strand-
Gene length (bp)994
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00213 OSCP ATP synthase delta (OSCP) subunit 1.6E-43 46 225

GO

GO Term Description Terminal node
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism Yes
GO:0015986 proton motive force-driven ATP synthesis Yes
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0006754 ATP biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0008152 metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0015078 proton transmembrane transporter activity No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008324 cation transmembrane transporter activity No
GO:0009058 biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:0006163 purine nucleotide metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0003824 catalytic activity No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0009201 ribonucleoside triphosphate biosynthetic process No
GO:0022857 transmembrane transporter activity No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0009145 purine nucleoside triphosphate biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0046034 ATP metabolic process No
GO:0009987 cellular process No
GO:1901576 organic substance biosynthetic process No
GO:0022803 passive transmembrane transporter activity No
GO:0044238 primary metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0009206 purine ribonucleoside triphosphate biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:0009259 ribonucleotide metabolic process No
GO:0015267 channel activity No
GO:0044281 small molecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016874 ligase activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0015252 proton channel activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0005216 ion channel activity No
GO:0009142 nucleoside triphosphate biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0005261 cation channel activity No
GO:0015075 ion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 569.08 342.91 795.26
5d_25C Five days - 25 degrees Celsius 419.73 254.32 585.15
7d_25C Seven days - 25 degrees Celsius 384.28 233.21 535.35
10d_25C Ten days - 25 degrees Celsius 323.11 196.84 449.38
7d_15C Seven days - 15 degrees Celsius 458.32 273.44 643.20
7d_30C Seven days - 30 degrees Celsius 330.22 201.80 458.64

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.171349 no
3d_25C 7d_25C 0.059534 no
3d_25C 7d_15C 0.388708 no
3d_25C 7d_30C 0.006000 yes
3d_25C 10d_25C 0.004045 yes
5d_25C 7d_25C 0.760785 no
5d_25C 7d_15C 0.769758 no
5d_25C 7d_30C 0.302361 no
5d_25C 10d_25C 0.256842 no
7d_25C 7d_15C 0.501100 no
7d_25C 7d_30C 0.557653 no
7d_25C 10d_25C 0.499110 no
7d_15C 7d_30C 0.152656 no
7d_15C 10d_25C 0.126596 no
7d_30C 10d_25C 0.951508 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9592.t1
MISARFARAGLRATQFSVPRTAAVNGIRTYATPAQDTRAPVALFGVDGTYASALYTASAKSAALDQTARAIANLG
ETLKGDKKLVGILSSPMLTDEDKKAIVEELFKVAGADKADKAGVVKNFLQTLSEHNRFSSLEGVCEKFATLMGAY
HGEIDLHITSAQELDAKTINRLEKAISKSQFSQGKKLKVITKVNPDIVGGLIVEIADRTVDLSVSSKIAKMNKAL
SDAV*
Coding >Pro_DTO377G3_2|g9592.t1
ATGATCTCCGCTCGCTTCGCCCGCGCTGGCCTGCGTGCCACCCAGTTCTCGGTTCCTCGCACCGCCGCCGTTAAC
GGAATCAGGACCTATGCCACCCCGGCCCAGGATACCCGCGCCCCCGTCGCCCTGTTCGGCGTTGATGGCACTTAC
GCCTCTGCTCTGTACACCGCTTCCGCCAAGTCCGCTGCTCTCGACCAGACTGCCCGTGCTATCGCCAACCTCGGC
GAGACCCTCAAGGGTGACAAGAAGCTCGTCGGCATCCTCAGCTCCCCTATGCTCACCGACGAGGACAAGAAGGCC
ATCGTGGAGGAGCTCTTCAAGGTCGCCGGTGCTGACAAGGCCGACAAGGCCGGTGTCGTCAAGAACTTCCTCCAG
ACTCTCTCCGAGCACAACCGTTTCAGCTCCCTCGAGGGTGTCTGCGAGAAGTTCGCTACCCTGATGGGCGCTTAC
CACGGCGAGATCGACCTCCACATCACCAGTGCTCAGGAGCTCGATGCCAAGACCATTAACCGTCTTGAGAAGGCC
ATTTCCAAGTCTCAGTTCAGCCAGGGCAAGAAGCTCAAGGTTATTACCAAGGTCAACCCTGACATCGTTGGTGGA
CTCATCGTTGAGATTGCCGACCGCACCGTCGACCTTAGCGTTTCTTCTAAGATCGCCAAGATGAACAAGGCTCTT
TCCGATGCTGTGTAA
Transcript >Pro_DTO377G3_2|g9592.t1
ATGATCTCCGCTCGCTTCGCCCGCGCTGGCCTGCGTGCCACCCAGTTCTCGGTTCCTCGCACCGCCGCCGTTAAC
GGAATCAGGACCTATGCCACCCCGGCCCAGGATACCCGCGCCCCCGTCGCCCTGTTCGGCGTTGATGGCACTTAC
GCCTCTGCTCTGTACACCGCTTCCGCCAAGTCCGCTGCTCTCGACCAGACTGCCCGTGCTATCGCCAACCTCGGC
GAGACCCTCAAGGGTGACAAGAAGCTCGTCGGCATCCTCAGCTCCCCTATGCTCACCGACGAGGACAAGAAGGCC
ATCGTGGAGGAGCTCTTCAAGGTCGCCGGTGCTGACAAGGCCGACAAGGCCGGTGTCGTCAAGAACTTCCTCCAG
ACTCTCTCCGAGCACAACCGTTTCAGCTCCCTCGAGGGTGTCTGCGAGAAGTTCGCTACCCTGATGGGCGCTTAC
CACGGCGAGATCGACCTCCACATCACCAGTGCTCAGGAGCTCGATGCCAAGACCATTAACCGTCTTGAGAAGGCC
ATTTCCAAGTCTCAGTTCAGCCAGGGCAAGAAGCTCAAGGTTATTACCAAGGTCAACCCTGACATCGTTGGTGGA
CTCATCGTTGAGATTGCCGACCGCACCGTCGACCTTAGCGTTTCTTCTAAGATCGCCAAGATGAACAAGGCTCTT
TCCGATGCTGTGTAA
Gene >Pro_DTO377G3_2|g9592.t1
ATGATCTCCGCTCGCTTCGCCCGCGCTGGCCTGCGTGCCACCCAGTTCTCGGTTCCTCGCACCGCCGCCGTTAAC
GGAATCAGGACCTATGCCACCCCGGCCCAGGATACCCGCGCCCCCGTCGCCCTGTTCGGCGTTGATGGCACTTAC
GCCTCTGCTCTGGTATGCACCTCCATCGCCTCGGTCTTGTCGCGACCGTGTGCTTCGCCTTTTCGCGACGAACAC
CCCGTCTTTCCCCGACCCCTCCCACACTCTTCAAAGCAGTGTTCAGATCCTCATCAAAACACTGCAAGCAAAAAC
CCGGAATGAATTACCCTTCTAACCATCCTCGTGAATAGTACACCGCTTCCGCCAAGTCCGCTGCTCTCGACCAGA
CTGCCCGTGCTATCGCCAACCTCGGCGAGACCCTCAAGGGTGACAAGAAGCTCGTCGGCATCCTCAGCTCCCCTA
TGCTCACCGACGAGGACAAGAAGGCCATCGTGGAGGAGCTCTTCAAGGTCGCCGGTGCTGACAAGGCCGACAAGG
CCGGTGTCGTCAAGAACTTCCTCCAGACTCTCTCCGAGCACAACCGTTTCAGCTCCCTCGAGGGTGTCTGCGAGA
AGTTCGCTACCCTGATGGGCGCTTACCACGGCGAGATCGACCTCCACATCACCAGTGCTCAGGTACGTACTCCAT
GAGCTGTGTTTCACTCGCAGAAAAAAAAATAAGGATATAAGCTAAAAGTTTGTCCGCAGGAGCTCGATGCCAAGA
CCATTAACCGTCTTGAGAAGGCCATTTCCAAGTCTCAGTTCAGCCAGGGCAAGAAGCTCAAGGTTATTACCAAGG
TTCGTTACAATCGATGGAATTTTTTTTTGTAGCTATTTACTAACTCATTGACCAGGTCAACCCTGACATCGTTGG
TGGACTCATCGTTGAGATTGCCGACCGCACCGTCGACCTTAGCGTTTCTTCTAAGATCGCCAAGATGAACAAGGC
TCTTTCCGATGCTGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail