Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9592.t1
Gene name
Locationscaffold_52:41701..42695
Strand-
Gene length (bp)994
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00213 OSCP ATP synthase delta (OSCP) subunit 8.2E-42 46 225

GO

GO Term Description Terminal node
GO:0015986 ATP synthesis coupled proton transport Yes
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism Yes
GO:0009117 nucleotide metabolic process No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0003824 catalytic activity No
GO:0046034 ATP metabolic process No
GO:0098655 cation transmembrane transport No
GO:0019637 organophosphate metabolic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0017111 nucleoside-triphosphatase activity No
GO:0018130 heterocycle biosynthetic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0042625 ATPase coupled ion transmembrane transporter activity No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0008152 metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006811 ion transport No
GO:0019438 aromatic compound biosynthetic process No
GO:0015399 primary active transmembrane transporter activity No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0009142 nucleoside triphosphate biosynthetic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0051234 establishment of localization No
GO:0022853 active ion transmembrane transporter activity No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0015078 proton transmembrane transporter activity No
GO:0071704 organic substance metabolic process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0009206 purine ribonucleoside triphosphate biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0006812 cation transport No
GO:1901564 organonitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0015672 monovalent inorganic cation transport No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0017144 drug metabolic process No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0019829 cation-transporting ATPase activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0006793 phosphorus metabolic process No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0008324 cation transmembrane transporter activity No
GO:0055085 transmembrane transport No
GO:0098662 inorganic cation transmembrane transport No
GO:0009987 cellular process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006810 transport No
GO:1901135 carbohydrate derivative metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0042623 ATPase activity, coupled No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0016887 ATPase activity No
GO:0009058 biosynthetic process No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0044237 cellular metabolic process No
GO:0042626 ATPase activity, coupled to transmembrane movement of substances No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0015985 energy coupled proton transport, down electrochemical gradient No
GO:1902600 proton transmembrane transport No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0016462 pyrophosphatase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0009145 purine nucleoside triphosphate biosynthetic process No
GO:0015075 ion transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0019693 ribose phosphate metabolic process No
GO:0034220 ion transmembrane transport No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006754 ATP biosynthetic process No
GO:0022857 transmembrane transporter activity No
GO:0098660 inorganic ion transmembrane transport No
GO:0044281 small molecule metabolic process No
GO:0009201 ribonucleoside triphosphate biosynthetic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9592.t1
MISARFARAGLRATQFSVPRTAAVNGIRTYATPAQDTRAPVALFGVDGTYASALYTASAKSAALDQTARAIANLG
ETLKGDKKLVGILSSPMLTDEDKKAIVEELFKVAGADKADKAGVVKNFLQTLSEHNRFSSLEGVCEKFATLMGAY
HGEIDLHITSAQELDAKTINRLEKAISKSQFSQGKKLKVITKVNPDIVGGLIVEIADRTVDLSVSSKIAKMNKAL
SDAV*
Coding >Pro_DTO377G3_2|g9592.t1
ATGATCTCCGCTCGCTTCGCCCGCGCTGGCCTGCGTGCCACCCAGTTCTCGGTTCCTCGCACCGCCGCCGTTAAC
GGAATCAGGACCTATGCCACCCCGGCCCAGGATACCCGCGCCCCCGTCGCCCTGTTCGGCGTTGATGGCACTTAC
GCCTCTGCTCTGTACACCGCTTCCGCCAAGTCCGCTGCTCTCGACCAGACTGCCCGTGCTATCGCCAACCTCGGC
GAGACCCTCAAGGGTGACAAGAAGCTCGTCGGCATCCTCAGCTCCCCTATGCTCACCGACGAGGACAAGAAGGCC
ATCGTGGAGGAGCTCTTCAAGGTCGCCGGTGCTGACAAGGCCGACAAGGCCGGTGTCGTCAAGAACTTCCTCCAG
ACTCTCTCCGAGCACAACCGTTTCAGCTCCCTCGAGGGTGTCTGCGAGAAGTTCGCTACCCTGATGGGCGCTTAC
CACGGCGAGATCGACCTCCACATCACCAGTGCTCAGGAGCTCGATGCCAAGACCATTAACCGTCTTGAGAAGGCC
ATTTCCAAGTCTCAGTTCAGCCAGGGCAAGAAGCTCAAGGTTATTACCAAGGTCAACCCTGACATCGTTGGTGGA
CTCATCGTTGAGATTGCCGACCGCACCGTCGACCTTAGCGTTTCTTCTAAGATCGCCAAGATGAACAAGGCTCTT
TCCGATGCTGTGTAA
Transcript >Pro_DTO377G3_2|g9592.t1
ATGATCTCCGCTCGCTTCGCCCGCGCTGGCCTGCGTGCCACCCAGTTCTCGGTTCCTCGCACCGCCGCCGTTAAC
GGAATCAGGACCTATGCCACCCCGGCCCAGGATACCCGCGCCCCCGTCGCCCTGTTCGGCGTTGATGGCACTTAC
GCCTCTGCTCTGTACACCGCTTCCGCCAAGTCCGCTGCTCTCGACCAGACTGCCCGTGCTATCGCCAACCTCGGC
GAGACCCTCAAGGGTGACAAGAAGCTCGTCGGCATCCTCAGCTCCCCTATGCTCACCGACGAGGACAAGAAGGCC
ATCGTGGAGGAGCTCTTCAAGGTCGCCGGTGCTGACAAGGCCGACAAGGCCGGTGTCGTCAAGAACTTCCTCCAG
ACTCTCTCCGAGCACAACCGTTTCAGCTCCCTCGAGGGTGTCTGCGAGAAGTTCGCTACCCTGATGGGCGCTTAC
CACGGCGAGATCGACCTCCACATCACCAGTGCTCAGGAGCTCGATGCCAAGACCATTAACCGTCTTGAGAAGGCC
ATTTCCAAGTCTCAGTTCAGCCAGGGCAAGAAGCTCAAGGTTATTACCAAGGTCAACCCTGACATCGTTGGTGGA
CTCATCGTTGAGATTGCCGACCGCACCGTCGACCTTAGCGTTTCTTCTAAGATCGCCAAGATGAACAAGGCTCTT
TCCGATGCTGTGTAA
Gene >Pro_DTO377G3_2|g9592.t1
ATGATCTCCGCTCGCTTCGCCCGCGCTGGCCTGCGTGCCACCCAGTTCTCGGTTCCTCGCACCGCCGCCGTTAAC
GGAATCAGGACCTATGCCACCCCGGCCCAGGATACCCGCGCCCCCGTCGCCCTGTTCGGCGTTGATGGCACTTAC
GCCTCTGCTCTGGTATGCACCTCCATCGCCTCGGTCTTGTCGCGACCGTGTGCTTCGCCTTTTCGCGACGAACAC
CCCGTCTTTCCCCGACCCCTCCCACACTCTTCAAAGCAGTGTTCAGATCCTCATCAAAACACTGCAAGCAAAAAC
CCGGAATGAATTACCCTTCTAACCATCCTCGTGAATAGTACACCGCTTCCGCCAAGTCCGCTGCTCTCGACCAGA
CTGCCCGTGCTATCGCCAACCTCGGCGAGACCCTCAAGGGTGACAAGAAGCTCGTCGGCATCCTCAGCTCCCCTA
TGCTCACCGACGAGGACAAGAAGGCCATCGTGGAGGAGCTCTTCAAGGTCGCCGGTGCTGACAAGGCCGACAAGG
CCGGTGTCGTCAAGAACTTCCTCCAGACTCTCTCCGAGCACAACCGTTTCAGCTCCCTCGAGGGTGTCTGCGAGA
AGTTCGCTACCCTGATGGGCGCTTACCACGGCGAGATCGACCTCCACATCACCAGTGCTCAGGTACGTACTCCAT
GAGCTGTGTTTCACTCGCAGAAAAAAAAATAAGGATATAAGCTAAAAGTTTGTCCGCAGGAGCTCGATGCCAAGA
CCATTAACCGTCTTGAGAAGGCCATTTCCAAGTCTCAGTTCAGCCAGGGCAAGAAGCTCAAGGTTATTACCAAGG
TTCGTTACAATCGATGGAATTTTTTTTTGTAGCTATTTACTAACTCATTGACCAGGTCAACCCTGACATCGTTGG
TGGACTCATCGTTGAGATTGCCGACCGCACCGTCGACCTTAGCGTTTCTTCTAAGATCGCCAAGATGAACAAGGC
TCTTTCCGATGCTGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail