Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9587.t1
Gene name
Locationscaffold_52:28145..29294
Strand-
Gene length (bp)1149
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00682 HMGL-like HMGL-like 5.8E-48 34 329

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 259.29 156.29 362.29
5d_25C Five days - 25 degrees Celsius 242.05 145.05 339.04
7d_25C Seven days - 25 degrees Celsius 213.59 129.30 297.88
10d_25C Ten days - 25 degrees Celsius 258.68 155.89 361.47
7d_15C Seven days - 15 degrees Celsius 390.90 223.62 558.18
7d_30C Seven days - 30 degrees Celsius 186.64 112.12 261.15

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.819818 no
3d_25C 7d_25C 0.446210 no
3d_25C 7d_15C 0.063693 no
3d_25C 7d_30C 0.135543 no
3d_25C 10d_25C 0.994748 no
5d_25C 7d_25C 0.654087 no
5d_25C 7d_15C 0.023923 yes
5d_25C 7d_30C 0.269079 no
5d_25C 10d_25C 0.832579 no
7d_25C 7d_15C 0.002761 yes
7d_25C 7d_30C 0.626616 no
7d_25C 10d_25C 0.452408 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.060388 no
7d_30C 10d_25C 0.146409 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9587.t1
MTITRPRLSLFSALRSPYSARRFSTESRLTSDHVRIVEVGARDGLQNEKKTISMQTKLELIERLAKTGVTTIEAG
SFVPAKWVPQMASTAEICEHLLTKPPQAQSTIAYNYLVPNIRGLENLVKILDDTGVSADATGETSKSATTTEVSL
FAAATEAFSKANTNCSITESLERIKPIVALARSKNIRVRGYVSVALGCPYEGPDVDPVKVADITATLLEMGADEV
SVADTTGMGTAPRTMELMQALKAAGIANTDLALHFHDTYGQALVNTIVGLEHGVRIFDSSVAGLGGCPYSKGATG
NVATEDLVHTIHSLGMHTGVSLDEMSKIGGWISEELGRANGSRAGKATLARLATEKASL*
Coding >Pro_DTO377G3_2|g9587.t1
ATGACGATAACCCGCCCCAGGTTGAGTCTTTTCTCTGCCCTACGATCTCCATACTCTGCACGCCGCTTCTCGACC
GAGTCGCGCTTAACATCGGACCATGTCCGCATCGTGGAGGTTGGCGCTCGGGATGGACTGCAGAATGAGAAAAAA
ACAATTTCAATGCAAACAAAGCTTGAGTTAATCGAGCGACTGGCTAAGACAGGTGTCACCACCATTGAAGCTGGC
TCATTTGTGCCCGCAAAATGGGTACCCCAGATGGCTAGCACAGCTGAGATTTGTGAGCACCTCCTTACAAAACCG
CCTCAAGCACAATCTACAATTGCATACAATTATCTTGTCCCCAACATCAGAGGACTGGAGAACCTGGTCAAGATC
CTGGATGACACAGGAGTCTCCGCGGACGCGACTGGGGAGACCTCAAAGTCAGCGACGACTACAGAGGTGTCTCTT
TTTGCTGCAGCAACGGAAGCTTTCTCTAAAGCTAACACCAACTGCTCCATTACCGAGTCACTGGAGCGCATCAAG
CCGATTGTCGCATTGGCAAGGAGCAAGAATATCCGGGTACGCGGATATGTCTCTGTTGCACTAGGATGCCCATAT
GAAGGCCCCGATGTGGATCCTGTCAAGGTGGCTGATATTACCGCCACCCTACTGGAGATGGGAGCGGATGAGGTC
TCAGTGGCGGACACAACGGGTATGGGCACCGCTCCTCGGACCATGGAGCTCATGCAAGCCCTCAAGGCTGCTGGC
ATCGCTAACACAGACTTGGCGTTGCACTTCCATGATACCTATGGACAGGCTTTGGTGAACACAATCGTCGGCCTG
GAGCATGGTGTCCGCATTTTCGACAGCAGTGTGGCTGGGCTTGGTGGTTGCCCGTATTCTAAGGGCGCGACAGGG
AATGTGGCGACGGAGGACCTTGTGCACACGATTCACAGCCTGGGAATGCATACCGGGGTCAGCTTAGATGAGATG
TCGAAAATCGGAGGTTGGATTAGTGAGGAGCTGGGCCGAGCTAATGGCAGCAGGGCTGGAAAAGCGACTCTCGCC
CGTCTCGCAACAGAAAAAGCGTCACTTTGA
Transcript >Pro_DTO377G3_2|g9587.t1
ATGACGATAACCCGCCCCAGGTTGAGTCTTTTCTCTGCCCTACGATCTCCATACTCTGCACGCCGCTTCTCGACC
GAGTCGCGCTTAACATCGGACCATGTCCGCATCGTGGAGGTTGGCGCTCGGGATGGACTGCAGAATGAGAAAAAA
ACAATTTCAATGCAAACAAAGCTTGAGTTAATCGAGCGACTGGCTAAGACAGGTGTCACCACCATTGAAGCTGGC
TCATTTGTGCCCGCAAAATGGGTACCCCAGATGGCTAGCACAGCTGAGATTTGTGAGCACCTCCTTACAAAACCG
CCTCAAGCACAATCTACAATTGCATACAATTATCTTGTCCCCAACATCAGAGGACTGGAGAACCTGGTCAAGATC
CTGGATGACACAGGAGTCTCCGCGGACGCGACTGGGGAGACCTCAAAGTCAGCGACGACTACAGAGGTGTCTCTT
TTTGCTGCAGCAACGGAAGCTTTCTCTAAAGCTAACACCAACTGCTCCATTACCGAGTCACTGGAGCGCATCAAG
CCGATTGTCGCATTGGCAAGGAGCAAGAATATCCGGGTACGCGGATATGTCTCTGTTGCACTAGGATGCCCATAT
GAAGGCCCCGATGTGGATCCTGTCAAGGTGGCTGATATTACCGCCACCCTACTGGAGATGGGAGCGGATGAGGTC
TCAGTGGCGGACACAACGGGTATGGGCACCGCTCCTCGGACCATGGAGCTCATGCAAGCCCTCAAGGCTGCTGGC
ATCGCTAACACAGACTTGGCGTTGCACTTCCATGATACCTATGGACAGGCTTTGGTGAACACAATCGTCGGCCTG
GAGCATGGTGTCCGCATTTTCGACAGCAGTGTGGCTGGGCTTGGTGGTTGCCCGTATTCTAAGGGCGCGACAGGG
AATGTGGCGACGGAGGACCTTGTGCACACGATTCACAGCCTGGGAATGCATACCGGGGTCAGCTTAGATGAGATG
TCGAAAATCGGAGGTTGGATTAGTGAGGAGCTGGGCCGAGCTAATGGCAGCAGGGCTGGAAAAGCGACTCTCGCC
CGTCTCGCAACAGAAAAAGCGTCACTTTGA
Gene >Pro_DTO377G3_2|g9587.t1
ATGACGATAACCCGCCCCAGGTTGAGTCTTTTCTCTGCCCTACGATCTCCATACTCTGCACGCCGCTTCTCGACC
GAGTCGCGCTTAACATCGGACCATGTCCGCATCGTGGAGGTTGGCGCTCGGGATGGACTGCAGAATGAGAAAAAA
ACAATTTCAATGCAAACAAAGCTTGAGTTAATCGAGCGACTGGCTAAGACAGGTGTCACCACCATTGAAGCTGGC
TCATTTGTGCCCGCAAAATGGGTACCCCAGGTATGACCTCAGCGGAGCATCATCGTGCCATTCCAGACGATAAAA
ACCGATTTGCTTACGTTACGACAGATGGCTAGCACAGCTGAGATTTGTGAGCACCTCCTTACAAAACCGCCTCAA
GCACAATCTACAATTGCATACAATTATCTTGTCCCCAACATCAGAGGACTGGAGAACCTGGTCAAGATCCTGGAT
GACACAGGAGTCTCCGCGGACGCGACTGGGGAGACCTCAAAGTCAGCGACGACTACAGAGGTGTCTCTTTTTGCT
GCAGCAACGGAAGCTTTCTCTAAAGCTAACACCAACTGCTCCATTACCGAGTCACTGGAGCGCATCAAGCCGATT
GTCGCATTGGCAAGGAGCAAGAATATCCGGGTACGCGGATATGTCTCTGTTGCACTAGGATGCCCATATGAAGGC
CCCGATGTGGATCCTGTCAAGGTGGCTGATATTACCGCCACCCTACTGGAGATGGGAGCGGATGAGGTCTCAGTG
GCGGACACAACGGGTATGGGCACCGCTCCTCGGACCATGGAGCTCATGCAAGCCCTCAAGGCTGCTGGCATCGCT
AACACAGACTTGGCGTTGCACTTCCATGATACCTATGGACAGGCTTTGGTGAACACAATCGTCGGCCTGGAGCAT
GGTGTCCGCATTTTCGACAGCAGTGTGGCTGGGCTTGGTGGTTGCCCGTATTCTAAGGGCGCGACAGGGAATGTG
GCGACGGAGGACCTTGTGCACACGATTCACAGCCTGGGAATGCATACCGGGGTCAGCTTAGATGAGATGTCGAAA
ATCGGAGGTTGGATTAGTGAGGAGCTGGGCCGAGCTAATGGCAGCAGGGCTGGAAAAGCGACTCTCGCCCGTCTC
GCAACAGAAAAAGCGTCACTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail