Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9570.t1
Gene name
Locationscaffold_51:73603..77326
Strand-
Gene length (bp)3723
Transcript length (bp)3666
Coding sequence length (bp)3666
Protein length (aa) 1222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12396 DUF3659 Protein of unknown function (DUF3659) 4.8E-18 160 218
PF12396 DUF3659 Protein of unknown function (DUF3659) 1.4E-17 249 307
PF12396 DUF3659 Protein of unknown function (DUF3659) 1.1E-19 512 573
PF12396 DUF3659 Protein of unknown function (DUF3659) 2.1E-20 585 644
PF12396 DUF3659 Protein of unknown function (DUF3659) 3.3E-16 660 716
PF12396 DUF3659 Protein of unknown function (DUF3659) 1.8E-19 730 787
PF12396 DUF3659 Protein of unknown function (DUF3659) 1.6E-17 799 858
PF12396 DUF3659 Protein of unknown function (DUF3659) 6.4E-16 872 927
PF12396 DUF3659 Protein of unknown function (DUF3659) 9.6E-19 936 993

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 1159 1181 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9570.t1
MSSPAVNKAPPKLGSKAGTPAKARKASGSSAASKPSTVTASPKVTKKTATPRKLSQKAPEPIEDDVDEQSIPETP
SPKSKRRTEQRRPVSPPDDAASQAPSVSGSAAPLSRGGSSLAGKAKDVAGKTKETAEKSVESVTSGAKDATKTAT
DNLPVPFDLSALKGLDVAEGGNILGQDGNPIGKVVEGDPEDLVGQTVGDDGEIVDEEGDLIGRVDILHEVADKAK
NAADDAQENVGEADLENVVTDIAQLEGLPVSDGGVIKNAAGQIVGRIVEGDPEDLIGYTLNDDGEIVDEDGDPIG
RVDLVPVEDQKKAIEEATGDATDKVDGAKGDVEDQYEDAQDDIPADQAKSAVDGAADEVEDGVSDAEGNVDKAKS
TAEDAAPDAEDATDSVDGAVDDATDTAEDGKINLEDNVDDAKDTAEDKVEGAEDTAEDAKDAAEETAEGVTDAPD
DKVEGAEDAAEDAAEDATDALDDKVEGAEDAAKDAAEDAAEDAQDTAEDAAEDVEENIPGLETLEGKVCNKLGYI
IDEATGKPVGQVTEGDPKKLAKLGSTLDDKGQFWDNRGNVIGQAKALPIEEHDGDEGPFSGLEGLVVGEDGFVVD
ENSTRVGRLIEGDAKKLSGRGVDEDGEILDRKGNVLGRAERLEPEEEPEEEEEAGPDFSAVNGLTCNKAGYVIGP
DGYPIARVVEGNPKELAGKKIDEGEIYDGKKVIGRVELIPEDEIDSKPEGIFAGMDSLFVTKDGFVEDDEGSIVG
KLVEGEAKKLRGRAVDEDGEITDKYGNVKGRAEPYEPPEEEPAPEEDLSILDGKVVNKSGNVVDPTTGAVVGRIL
EGDKRLAGCKVDGKGQIWGDNGKVVGRAGLIPGAEQDKAEGPFFGFDNAIVGKDGVVQDGDKIIGRLIEGDAKRL
LGRKVDEEGDVLDKNGNSIGKAERWEPEEKKRDINPMSGRKVNKEGEVRDEDGNLIGKLTAGNLATLIGKSIDDN
GYVIDNDGNKIGECTLLENIPEPEEEVEEGPTAEEQEAAAKAESDRQLAEKMISILSQTLDRVKPVCKQITEACD
KADHTKKEDLDEEKLVQTVKPLLEEGGRILQECNGAIRALDPDGRIAATAKARAASRDATPEEYQLADLIKELTE
TVVKTIDNGKKRIADMPHAKKALNPLWGLLSEPLFQIIAAVGLLLTGVLGLVGRLLDGLGLGGLLNGLLGSLGLD
KIINGLGLGGLTDALGLGGNK*
Coding >Pro_DTO377G3_2|g9570.t1
ATGTCTTCCCCCGCCGTGAACAAAGCACCCCCAAAGCTGGGCTCCAAGGCCGGAACCCCCGCCAAAGCCCGCAAA
GCCTCCGGCTCCAGCGCAGCCAGCAAGCCCAGCACTGTCACCGCAAGCCCCAAGGTCACAAAGAAGACCGCCACA
CCCCGCAAACTCTCCCAGAAAGCCCCCGAACCAATTGAAGACGACGTCGACGAGCAGTCTATCCCAGAGACACCC
TCCCCGAAGTCAAAGAGACGCACCGAGCAGCGCCGCCCCGTCTCCCCACCCGACGACGCCGCATCCCAGGCTCCT
TCTGTCTCCGGCTCCGCAGCCCCACTCAGCCGCGGCGGCTCCAGCTTGGCCGGCAAGGCTAAGGATGTCGCTGGC
AAGACGAAGGAGACAGCCGAGAAGAGTGTTGAAAGTGTCACAAGTGGCGCCAAGGATGCCACCAAGACTGCTACC
GATAACCTACCCGTGCCGTTCGACCTGTCTGCTTTGAAGGGTCTTGATGTCGCCGAGGGCGGCAATATTCTAGGA
CAGGATGGGAACCCCATTGGCAAGGTTGTCGAGGGGGATCCAGAGGATCTCGTCGGACAAACCGTTGGTGATGAC
GGCGAGATTGTTGACGAGGAAGGTGATTTGATTGGTCGCGTCGATATCTTGCACGAGGTCGCGGACAAAGCTAAG
AACGCCGCCGATGACGCCCAGGAGAACGTCGGAGAGGCTGATCTCGAGAACGTTGTTACGGACATCGCTCAGCTT
GAAGGCCTCCCTGTTTCTGATGGCGGTGTTATCAAGAACGCTGCTGGTCAGATCGTCGGCCGTATTGTGGAGGGT
GACCCTGAAGATCTTATCGGGTATACCCTCAACGACGACGGTGAAATTGTTGATGAAGATGGCGATCCCATTGGC
CGTGTTGATTTGGTTCCTGTTGAGGATCAGAAGAAGGCCATCGAAGAGGCCACTGGTGATGCCACTGACAAGGTC
GATGGCGCTAAGGGAGATGTTGAGGATCAGTACGAAGATGCTCAGGACGATATCCCCGCCGATCAGGCTAAGAGC
GCTGTTGATGGCGCGGCTGATGAGGTTGAAGACGGTGTTTCCGATGCCGAAGGGAATGTCGACAAGGCTAAGTCT
ACCGCCGAAGATGCCGCCCCCGACGCAGAAGATGCTACTGATTCCGTTGATGGCGCTGTCGACGATGCTACGGAC
ACCGCCGAAGATGGCAAGATTAACCTCGAGGATAATGTCGACGACGCCAAGGATACCGCCGAAGACAAGGTTGAA
GGTGCCGAAGATACCGCCGAAGACGCCAAGGATGCCGCTGAAGAGACCGCCGAAGGTGTTACCGATGCCCCCGAC
GACAAGGTCGAAGGCGCCGAAGATGCCGCCGAAGATGCCGCCGAAGATGCAACCGATGCCCTCGACGACAAGGTC
GAAGGCGCCGAAGATGCCGCCAAAGATGCCGCCGAAGATGCCGCCGAAGATGCCCAGGACACCGCCGAGGATGCT
GCCGAAGATGTCGAGGAAAATATCCCCGGATTGGAGACCCTCGAAGGCAAGGTCTGCAACAAGCTCGGCTACATC
ATCGACGAAGCAACCGGCAAGCCCGTTGGCCAAGTGACCGAAGGTGACCCCAAGAAACTAGCTAAGCTCGGCTCG
ACACTCGACGACAAGGGCCAGTTCTGGGACAACCGCGGCAATGTGATCGGCCAAGCTAAGGCACTCCCTATCGAG
GAACACGATGGCGACGAAGGCCCCTTCTCCGGTCTAGAGGGTCTCGTTGTCGGTGAAGACGGCTTTGTGGTCGAC
GAGAACTCGACCCGCGTCGGCCGTCTGATCGAAGGCGATGCGAAGAAACTGAGCGGCCGTGGCGTTGACGAGGAT
GGCGAAATCCTCGACCGCAAGGGTAACGTCCTTGGACGGGCTGAGCGCCTCGAACCCGAGGAAGAGCCCGAGGAG
GAGGAAGAGGCTGGTCCTGACTTTTCCGCTGTCAATGGCCTCACATGCAACAAGGCAGGCTATGTCATCGGACCC
GACGGCTATCCGATTGCCCGTGTTGTCGAGGGTAACCCCAAGGAGCTCGCCGGTAAGAAGATTGACGAGGGTGAG
ATTTACGACGGAAAGAAGGTCATTGGCCGTGTGGAGCTTATCCCCGAGGATGAGATCGACAGTAAGCCCGAGGGT
ATCTTCGCTGGCATGGACAGCCTCTTTGTGACCAAGGATGGATTCGTCGAGGATGATGAGGGATCCATTGTTGGT
AAGCTTGTCGAAGGCGAGGCTAAGAAGCTTCGTGGTCGTGCTGTCGACGAGGATGGAGAGATCACCGATAAGTAC
GGAAATGTCAAGGGCCGTGCTGAGCCCTACGAGCCCCCCGAGGAGGAGCCCGCTCCCGAAGAAGACCTCTCTATT
CTCGATGGCAAGGTCGTTAATAAGTCTGGCAATGTTGTTGATCCTACTACTGGTGCAGTCGTTGGACGTATCCTC
GAAGGTGATAAGCGCCTCGCTGGATGTAAGGTCGATGGCAAGGGTCAAATCTGGGGTGACAATGGTAAGGTTGTT
GGACGCGCTGGGCTTATCCCTGGCGCTGAGCAAGATAAGGCTGAAGGTCCATTCTTTGGATTCGATAACGCTATT
GTCGGCAAAGATGGAGTTGTGCAAGACGGTGACAAGATCATCGGACGTCTAATTGAAGGCGACGCCAAGCGTCTC
CTTGGCCGTAAGGTTGACGAGGAGGGTGACGTCCTCGATAAGAACGGCAACTCTATCGGTAAGGCCGAGCGTTGG
GAGCCTGAGGAGAAGAAGCGAGATATCAACCCCATGTCTGGTCGCAAGGTCAATAAGGAGGGCGAAGTCCGCGAT
GAGGACGGCAACCTTATTGGCAAGCTGACTGCGGGTAACCTCGCCACGCTGATCGGCAAGAGTATTGATGACAAC
GGCTATGTCATTGACAACGATGGCAATAAGATCGGCGAATGCACCTTGCTTGAGAACATCCCCGAGCCCGAGGAG
GAGGTCGAGGAGGGGCCCACGGCCGAAGAACAGGAGGCTGCGGCGAAGGCTGAGTCCGACCGACAGCTCGCCGAG
AAGATGATCTCTATCCTTAGCCAGACTCTTGACCGAGTCAAGCCTGTGTGTAAGCAGATCACTGAGGCCTGCGAT
AAAGCCGACCATACCAAGAAGGAGGACCTTGACGAGGAGAAGCTTGTTCAAACCGTCAAGCCGCTCCTCGAAGAA
GGCGGCCGCATTCTGCAAGAGTGCAACGGAGCCATCCGCGCTCTTGACCCCGATGGACGCATCGCCGCGACCGCT
AAGGCGCGCGCTGCTTCTCGCGATGCCACTCCTGAGGAGTATCAGCTTGCCGACCTGATCAAGGAGCTCACTGAG
ACGGTTGTCAAGACCATTGACAACGGCAAGAAACGTATTGCTGATATGCCTCACGCCAAGAAAGCGCTGAACCCC
CTCTGGGGTCTGCTCTCTGAGCCGTTGTTCCAGATCATCGCTGCCGTTGGCTTGTTGCTTACTGGTGTGCTTGGC
TTGGTTGGTCGTCTGCTTGATGGTCTTGGTCTCGGTGGATTGTTGAATGGACTGCTTGGCAGTCTTGGATTGGAT
AAAATAATCAATGGACTTGGTCTGGGAGGTCTGACTGACGCTCTTGGACTTGGAGGAAACAAATGA
Transcript >Pro_DTO377G3_2|g9570.t1
ATGTCTTCCCCCGCCGTGAACAAAGCACCCCCAAAGCTGGGCTCCAAGGCCGGAACCCCCGCCAAAGCCCGCAAA
GCCTCCGGCTCCAGCGCAGCCAGCAAGCCCAGCACTGTCACCGCAAGCCCCAAGGTCACAAAGAAGACCGCCACA
CCCCGCAAACTCTCCCAGAAAGCCCCCGAACCAATTGAAGACGACGTCGACGAGCAGTCTATCCCAGAGACACCC
TCCCCGAAGTCAAAGAGACGCACCGAGCAGCGCCGCCCCGTCTCCCCACCCGACGACGCCGCATCCCAGGCTCCT
TCTGTCTCCGGCTCCGCAGCCCCACTCAGCCGCGGCGGCTCCAGCTTGGCCGGCAAGGCTAAGGATGTCGCTGGC
AAGACGAAGGAGACAGCCGAGAAGAGTGTTGAAAGTGTCACAAGTGGCGCCAAGGATGCCACCAAGACTGCTACC
GATAACCTACCCGTGCCGTTCGACCTGTCTGCTTTGAAGGGTCTTGATGTCGCCGAGGGCGGCAATATTCTAGGA
CAGGATGGGAACCCCATTGGCAAGGTTGTCGAGGGGGATCCAGAGGATCTCGTCGGACAAACCGTTGGTGATGAC
GGCGAGATTGTTGACGAGGAAGGTGATTTGATTGGTCGCGTCGATATCTTGCACGAGGTCGCGGACAAAGCTAAG
AACGCCGCCGATGACGCCCAGGAGAACGTCGGAGAGGCTGATCTCGAGAACGTTGTTACGGACATCGCTCAGCTT
GAAGGCCTCCCTGTTTCTGATGGCGGTGTTATCAAGAACGCTGCTGGTCAGATCGTCGGCCGTATTGTGGAGGGT
GACCCTGAAGATCTTATCGGGTATACCCTCAACGACGACGGTGAAATTGTTGATGAAGATGGCGATCCCATTGGC
CGTGTTGATTTGGTTCCTGTTGAGGATCAGAAGAAGGCCATCGAAGAGGCCACTGGTGATGCCACTGACAAGGTC
GATGGCGCTAAGGGAGATGTTGAGGATCAGTACGAAGATGCTCAGGACGATATCCCCGCCGATCAGGCTAAGAGC
GCTGTTGATGGCGCGGCTGATGAGGTTGAAGACGGTGTTTCCGATGCCGAAGGGAATGTCGACAAGGCTAAGTCT
ACCGCCGAAGATGCCGCCCCCGACGCAGAAGATGCTACTGATTCCGTTGATGGCGCTGTCGACGATGCTACGGAC
ACCGCCGAAGATGGCAAGATTAACCTCGAGGATAATGTCGACGACGCCAAGGATACCGCCGAAGACAAGGTTGAA
GGTGCCGAAGATACCGCCGAAGACGCCAAGGATGCCGCTGAAGAGACCGCCGAAGGTGTTACCGATGCCCCCGAC
GACAAGGTCGAAGGCGCCGAAGATGCCGCCGAAGATGCCGCCGAAGATGCAACCGATGCCCTCGACGACAAGGTC
GAAGGCGCCGAAGATGCCGCCAAAGATGCCGCCGAAGATGCCGCCGAAGATGCCCAGGACACCGCCGAGGATGCT
GCCGAAGATGTCGAGGAAAATATCCCCGGATTGGAGACCCTCGAAGGCAAGGTCTGCAACAAGCTCGGCTACATC
ATCGACGAAGCAACCGGCAAGCCCGTTGGCCAAGTGACCGAAGGTGACCCCAAGAAACTAGCTAAGCTCGGCTCG
ACACTCGACGACAAGGGCCAGTTCTGGGACAACCGCGGCAATGTGATCGGCCAAGCTAAGGCACTCCCTATCGAG
GAACACGATGGCGACGAAGGCCCCTTCTCCGGTCTAGAGGGTCTCGTTGTCGGTGAAGACGGCTTTGTGGTCGAC
GAGAACTCGACCCGCGTCGGCCGTCTGATCGAAGGCGATGCGAAGAAACTGAGCGGCCGTGGCGTTGACGAGGAT
GGCGAAATCCTCGACCGCAAGGGTAACGTCCTTGGACGGGCTGAGCGCCTCGAACCCGAGGAAGAGCCCGAGGAG
GAGGAAGAGGCTGGTCCTGACTTTTCCGCTGTCAATGGCCTCACATGCAACAAGGCAGGCTATGTCATCGGACCC
GACGGCTATCCGATTGCCCGTGTTGTCGAGGGTAACCCCAAGGAGCTCGCCGGTAAGAAGATTGACGAGGGTGAG
ATTTACGACGGAAAGAAGGTCATTGGCCGTGTGGAGCTTATCCCCGAGGATGAGATCGACAGTAAGCCCGAGGGT
ATCTTCGCTGGCATGGACAGCCTCTTTGTGACCAAGGATGGATTCGTCGAGGATGATGAGGGATCCATTGTTGGT
AAGCTTGTCGAAGGCGAGGCTAAGAAGCTTCGTGGTCGTGCTGTCGACGAGGATGGAGAGATCACCGATAAGTAC
GGAAATGTCAAGGGCCGTGCTGAGCCCTACGAGCCCCCCGAGGAGGAGCCCGCTCCCGAAGAAGACCTCTCTATT
CTCGATGGCAAGGTCGTTAATAAGTCTGGCAATGTTGTTGATCCTACTACTGGTGCAGTCGTTGGACGTATCCTC
GAAGGTGATAAGCGCCTCGCTGGATGTAAGGTCGATGGCAAGGGTCAAATCTGGGGTGACAATGGTAAGGTTGTT
GGACGCGCTGGGCTTATCCCTGGCGCTGAGCAAGATAAGGCTGAAGGTCCATTCTTTGGATTCGATAACGCTATT
GTCGGCAAAGATGGAGTTGTGCAAGACGGTGACAAGATCATCGGACGTCTAATTGAAGGCGACGCCAAGCGTCTC
CTTGGCCGTAAGGTTGACGAGGAGGGTGACGTCCTCGATAAGAACGGCAACTCTATCGGTAAGGCCGAGCGTTGG
GAGCCTGAGGAGAAGAAGCGAGATATCAACCCCATGTCTGGTCGCAAGGTCAATAAGGAGGGCGAAGTCCGCGAT
GAGGACGGCAACCTTATTGGCAAGCTGACTGCGGGTAACCTCGCCACGCTGATCGGCAAGAGTATTGATGACAAC
GGCTATGTCATTGACAACGATGGCAATAAGATCGGCGAATGCACCTTGCTTGAGAACATCCCCGAGCCCGAGGAG
GAGGTCGAGGAGGGGCCCACGGCCGAAGAACAGGAGGCTGCGGCGAAGGCTGAGTCCGACCGACAGCTCGCCGAG
AAGATGATCTCTATCCTTAGCCAGACTCTTGACCGAGTCAAGCCTGTGTGTAAGCAGATCACTGAGGCCTGCGAT
AAAGCCGACCATACCAAGAAGGAGGACCTTGACGAGGAGAAGCTTGTTCAAACCGTCAAGCCGCTCCTCGAAGAA
GGCGGCCGCATTCTGCAAGAGTGCAACGGAGCCATCCGCGCTCTTGACCCCGATGGACGCATCGCCGCGACCGCT
AAGGCGCGCGCTGCTTCTCGCGATGCCACTCCTGAGGAGTATCAGCTTGCCGACCTGATCAAGGAGCTCACTGAG
ACGGTTGTCAAGACCATTGACAACGGCAAGAAACGTATTGCTGATATGCCTCACGCCAAGAAAGCGCTGAACCCC
CTCTGGGGTCTGCTCTCTGAGCCGTTGTTCCAGATCATCGCTGCCGTTGGCTTGTTGCTTACTGGTGTGCTTGGC
TTGGTTGGTCGTCTGCTTGATGGTCTTGGTCTCGGTGGATTGTTGAATGGACTGCTTGGCAGTCTTGGATTGGAT
AAAATAATCAATGGACTTGGTCTGGGAGGTCTGACTGACGCTCTTGGACTTGGAGGAAACAAATGA
Gene >Pro_DTO377G3_2|g9570.t1
ATGTCTTCCCCCGCCGTGAACAAAGCACCCCCAAAGCTGGGCTCCAAGGCCGGAACCCCCGCCAAAGCCCGCAAA
GCCTCCGGCTCCAGCGCAGCCAGCAAGCCCAGCACTGTCACCGCAAGCCCCAAGGTCACAAAGAAGACCGCCACA
CCCCGCAAACTCTCCCAGAAAGCCCCCGAACCAATTGAAGACGACGTCGACGAGCAGTCTATCCCAGAGACACCC
TCCCCGAAGTCAAAGAGACGCACCGAGCAGCGCCGCCCCGTCTCCCCACCCGACGACGCCGCATCCCAGGCTCCT
TCTGTCTCCGGCTCCGCAGCCCCACTCAGCCGCGGCGGCTCCAGCTTGGCCGGCAAGGCTAAGGATGTCGCTGGC
AAGACGAAGGAGACAGCCGAGAAGAGTGTTGAAAGTGTCACAAGTGGCGCCAAGGATGCCACCAAGACTGCTACC
GATAACCTACCCGTGCCGTTCGACCTGTCTGCTTTGAAGGGTCTTGATGTCGCCGAGGGCGGCAATATTCTAGGA
CAGGATGGGAACCCCATTGGCAAGGTTGTCGAGGGGGATCCAGAGGATCTCGTCGGACAAACCGTTGGTGATGAC
GGCGAGATTGTTGACGAGGAAGGTGATTTGATTGGTCGCGTCGATATCTTGCACGAGGTCGCGGACAAAGCTAAG
AACGCCGCCGATGACGCCCAGGAGAACGTCGGAGAGGCTGATCTCGAGAACGTTGTTACGGACATCGCTCAGCTT
GAAGGCCTCCCTGTTTCTGATGGCGGTGTTATCAAGAACGCTGCTGGTCAGATCGTCGGCCGTATTGTGGAGGGT
GACCCTGAAGATCTTATCGGGTATACCCTCAACGACGACGGTGAAATTGTTGATGAAGATGGCGATCCCATTGGC
CGTGTTGATTTGGTTCCTGTTGAGGATCAGAAGAAGGCCATCGAAGAGGCCACTGGTGATGCCACTGACAAGGTC
GATGGCGCTAAGGGAGATGTTGAGGATCAGTACGAAGATGCTCAGGACGATATCCCCGCCGATCAGGCTAAGAGC
GCTGTTGATGGCGCGGCTGATGAGGTTGAAGACGGTGTTTCCGATGCCGAAGGGAATGTCGACAAGGCTAAGTCT
ACCGCCGAAGATGCCGCCCCCGACGCAGAAGATGCTACTGATTCCGTTGATGGCGCTGTCGACGATGCTACGGAC
ACCGCCGAAGATGGCAAGATTAACCTCGAGGATAATGTCGACGACGCCAAGGATACCGCCGAAGACAAGGTTGAA
GGTGCCGAAGATACCGCCGAAGACGCCAAGGATGCCGCTGAAGAGACCGCCGAAGGTGTTACCGATGCCCCCGAC
GACAAGGTCGAAGGCGCCGAAGATGCCGCCGAAGATGCCGCCGAAGATGCAACCGATGCCCTCGACGACAAGGTC
GAAGGCGCCGAAGATGCCGCCAAAGATGCCGCCGAAGATGCCGCCGAAGATGCCCAGGACACCGCCGAGGATGCT
GCCGAAGATGTCGAGGAAAATATCCCCGGATTGGAGACCCTCGAAGGCAAGGTCTGCAACAAGCTCGGCTACATC
ATCGACGAAGCAACCGGCAAGCCCGTTGGCCAAGTGACCGAAGGTGACCCCAAGAAACTAGCTAAGCTCGGCTCG
ACACTCGACGACAAGGGCCAGTTCTGGGACAACCGCGGCAATGTGATCGGCCAAGCTAAGGCACTCCCTATCGAG
GAACACGATGGCGACGAAGGCCCCTTCTCCGGTCTAGAGGGTCTCGTTGTCGGTGAAGACGGCTTTGTGGTCGAC
GAGAACTCGACCCGCGTCGGCCGTCTGATCGAAGGCGATGCGAAGAAACTGAGCGGCCGTGGCGTTGACGAGGAT
GGCGAAATCCTCGACCGCAAGGGTAACGTCCTTGGACGGGCTGAGCGCCTCGAACCCGAGGAAGAGCCCGAGGAG
GAGGAAGAGGCTGGTCCTGACTTTTCCGCTGTCAATGGCCTCACATGCAACAAGGCAGGCTATGTCATCGGACCC
GACGGCTATCCGATTGCCCGTGTTGTCGAGGGTAACCCCAAGGAGCTCGCCGGTAAGAAGATTGACGAGGGTGAG
ATTTACGACGGAAAGAAGGTCATTGGCCGTGTGGAGCTTATCCCCGAGGATGAGATCGACAGTAAGCCCGAGGGT
ATCTTCGCTGGCATGGACAGCCTCTTTGTGACCAAGGATGGATTCGTCGAGGATGATGAGGGATCCATTGTTGGT
AAGCTTGTCGAAGGCGAGGCTAAGAAGCTTCGTGGTCGTGCTGTCGACGAGGATGGAGAGATCACCGATAAGTAC
GGAAATGTCAAGGGCCGTGCTGAGCCCTACGAGCCCCCCGAGGAGGAGCCCGCTCCCGAAGAAGACCTCTCTATT
CTCGATGGCAAGGTCGTTAATAAGTCTGGCAATGTTGTTGATCCTACTACTGGTGCAGTCGTTGGACGTATCCTC
GAAGGTGATAAGCGCCTCGCTGGATGTAAGGTCGATGGCAAGGGTCAAATCTGGGGTGACAATGGTAAGGTTGTT
GGACGCGCTGGGCTTATCCCTGGCGCTGAGCAAGATAAGGCTGAAGGTCCATTCTTTGGATTCGATAACGCTATT
GTCGGCAAAGATGGAGTTGTGCAAGACGGTGACAAGATCATCGGACGTCTAATTGAAGGCGACGCCAAGCGTCTC
CTTGGCCGTAAGGTTGACGAGGAGGGTGACGTCCTCGATAAGAACGGCAACTCTATCGGTAAGGCCGAGCGTTGG
GAGCCTGAGGAGAAGAAGCGAGATATCAACCCCATGTCTGGTCGCAAGGTCAATAAGGAGGGCGAAGTCCGCGAT
GAGGACGGCAACCTTATTGGCAAGCTGACTGCGGGTAACCTCGCCACGCTGATCGGCAAGAGTATTGATGACAAC
GGCTATGTCATTGACAACGATGGCAATAAGATCGGCGAATGCACCTTGCTTGAGAACATCCCCGAGCCCGAGGAG
GAGGTCGAGGAGGGGCCCACGGCCGAAGAACAGGAGGCTGCGGCGAAGGCTGAGTCCGACCGACAGCTCGCCGAG
AAGATGATCTCTATCCTTAGCCAGACTCTTGACCGAGTCAAGCCTGTGTGTAAGCAGATCACTGAGGTAAGTTCC
AACCCGACATTGAAGACCTCAAAAGCAATATACTAACATAACTTGCAGGCCTGCGATAAAGCCGACCATACCAAG
AAGGAGGACCTTGACGAGGAGAAGCTTGTTCAAACCGTCAAGCCGCTCCTCGAAGAAGGCGGCCGCATTCTGCAA
GAGTGCAACGGAGCCATCCGCGCTCTTGACCCCGATGGACGCATCGCCGCGACCGCTAAGGCGCGCGCTGCTTCT
CGCGATGCCACTCCTGAGGAGTATCAGCTTGCCGACCTGATCAAGGAGCTCACTGAGACGGTTGTCAAGACCATT
GACAACGGCAAGAAACGTATTGCTGATATGCCTCACGCCAAGAAAGCGCTGAACCCCCTCTGGGGTCTGCTCTCT
GAGCCGTTGTTCCAGATCATCGCTGCCGTTGGCTTGTTGCTTACTGGTGTGCTTGGCTTGGTTGGTCGTCTGCTT
GATGGTCTTGGTCTCGGTGGATTGTTGAATGGACTGCTTGGCAGTCTTGGATTGGATAAAATAATCAATGGACTT
GGTCTGGGAGGTCTGACTGACGCTCTTGGACTTGGAGGAAACAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail