Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9564.t1
Gene name
Locationscaffold_51:52359..53473
Strand-
Gene length (bp)1114
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 2.8E-40 123 304
PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain 1.1E-10 69 336

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0051287 NAD binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0005488 binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 10.65 3.83 17.48
5d_25C Five days - 25 degrees Celsius 4.48 1.02 7.95
7d_25C Seven days - 25 degrees Celsius 3.16 0.59 5.73
10d_25C Ten days - 25 degrees Celsius 2.84 0.47 5.21
7d_15C Seven days - 15 degrees Celsius 1.45 0.00 2.99
7d_30C Seven days - 30 degrees Celsius 5.85 1.63 10.07

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.027278 yes
3d_25C 7d_25C 0.001278 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.125400 no
3d_25C 10d_25C 0.001278 yes
5d_25C 7d_25C 0.494797 no
5d_25C 7d_15C 0.037351 yes
5d_25C 7d_30C 0.614607 no
5d_25C 10d_25C 0.379102 no
7d_25C 7d_15C 0.158964 no
7d_25C 7d_30C 0.151030 no
7d_25C 10d_25C 0.875724 no
7d_15C 7d_30C 0.010411 yes
7d_15C 10d_25C 0.253272 no
7d_30C 10d_25C 0.110283 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9564.t1
MTKPIVLHLGDDIRWNHDQYSKFQDVFEIRRSYSMSRPEFIRALKERQFGDFFAIYRPFWNTGGEMGNWDEELIS
LLPDSCKVYASAGAGFDWVDTAALAKKGVVYCNAAAACTESVADAAIWLIISTFRLFSWSHIAARALDVDAFVDA
NRNLAMVSHNPNGHTLGIIGFGQIGRRTAEKAFLALNMKIHYYDIVQMPAQLEAVSKATYHKTMDSLLAVSDCVM
VATPFSGETLLNASLLAKMKDGSRLINIARGKLLDESALVDALKSGKLAAAGLDVHYNEPRVSPELASMKNVEMM
SHNAGASVDSHIGFERLGMENITAFYQTGKAVTPVNAHLVAKATGSKL*
Coding >Pro_DTO377G3_2|g9564.t1
ATGACCAAACCAATTGTCCTCCATCTCGGTGATGACATCCGCTGGAATCACGACCAATACAGCAAGTTCCAAGAT
GTCTTCGAGATCCGCCGGTCCTACAGCATGTCTCGGCCGGAGTTTATCCGAGCCCTGAAAGAGCGCCAATTCGGC
GATTTCTTCGCCATCTACCGCCCATTCTGGAATACCGGCGGCGAGATGGGGAACTGGGATGAGGAGCTCATCTCA
CTGCTACCAGACTCTTGCAAGGTCTACGCCAGTGCAGGTGCTGGATTTGACTGGGTTGATACCGCAGCTTTGGCG
AAGAAGGGGGTGGTTTACTGCAATGCTGCAGCAGCATGCACAGAATCCGTCGCCGACGCCGCAATCTGGCTCATA
ATCTCCACATTCCGCCTGTTCTCTTGGTCACACATTGCCGCACGCGCACTGGATGTCGATGCATTTGTCGACGCA
AACCGCAACCTGGCGATGGTCTCACACAACCCCAATGGACACACACTTGGAATCATTGGCTTCGGCCAGATCGGC
CGGCGCACTGCCGAGAAGGCGTTCCTGGCCTTGAACATGAAGATTCACTATTACGACATCGTGCAGATGCCCGCA
CAGCTGGAAGCCGTCTCGAAGGCAACATACCATAAGACCATGGACAGTCTCCTTGCTGTTTCAGACTGTGTCATG
GTTGCAACGCCGTTTAGCGGGGAGACACTCCTCAATGCATCTCTGCTGGCAAAGATGAAGGACGGCTCGCGACTG
ATTAATATCGCCCGTGGCAAGTTGCTCGATGAGAGTGCCCTTGTTGACGCACTGAAGAGTGGTAAGCTTGCTGCT
GCGGGCTTGGATGTGCACTACAATGAGCCACGCGTCAGCCCGGAGCTTGCAAGCATGAAGAATGTTGAGATGATG
TCGCACAATGCTGGTGCTTCAGTGGACTCACATATCGGATTTGAGAGGTTGGGTATGGAGAATATTACTGCTTTC
TATCAAACTGGAAAGGCTGTTACGCCTGTCAATGCGCACCTAGTCGCCAAAGCGACAGGCTCAAAGCTATAG
Transcript >Pro_DTO377G3_2|g9564.t1
ATGACCAAACCAATTGTCCTCCATCTCGGTGATGACATCCGCTGGAATCACGACCAATACAGCAAGTTCCAAGAT
GTCTTCGAGATCCGCCGGTCCTACAGCATGTCTCGGCCGGAGTTTATCCGAGCCCTGAAAGAGCGCCAATTCGGC
GATTTCTTCGCCATCTACCGCCCATTCTGGAATACCGGCGGCGAGATGGGGAACTGGGATGAGGAGCTCATCTCA
CTGCTACCAGACTCTTGCAAGGTCTACGCCAGTGCAGGTGCTGGATTTGACTGGGTTGATACCGCAGCTTTGGCG
AAGAAGGGGGTGGTTTACTGCAATGCTGCAGCAGCATGCACAGAATCCGTCGCCGACGCCGCAATCTGGCTCATA
ATCTCCACATTCCGCCTGTTCTCTTGGTCACACATTGCCGCACGCGCACTGGATGTCGATGCATTTGTCGACGCA
AACCGCAACCTGGCGATGGTCTCACACAACCCCAATGGACACACACTTGGAATCATTGGCTTCGGCCAGATCGGC
CGGCGCACTGCCGAGAAGGCGTTCCTGGCCTTGAACATGAAGATTCACTATTACGACATCGTGCAGATGCCCGCA
CAGCTGGAAGCCGTCTCGAAGGCAACATACCATAAGACCATGGACAGTCTCCTTGCTGTTTCAGACTGTGTCATG
GTTGCAACGCCGTTTAGCGGGGAGACACTCCTCAATGCATCTCTGCTGGCAAAGATGAAGGACGGCTCGCGACTG
ATTAATATCGCCCGTGGCAAGTTGCTCGATGAGAGTGCCCTTGTTGACGCACTGAAGAGTGGTAAGCTTGCTGCT
GCGGGCTTGGATGTGCACTACAATGAGCCACGCGTCAGCCCGGAGCTTGCAAGCATGAAGAATGTTGAGATGATG
TCGCACAATGCTGGTGCTTCAGTGGACTCACATATCGGATTTGAGAGGTTGGGTATGGAGAATATTACTGCTTTC
TATCAAACTGGAAAGGCTGTTACGCCTGTCAATGCGCACCTAGTCGCCAAAGCGACAGGCTCAAAGCTATAG
Gene >Pro_DTO377G3_2|g9564.t1
ATGACCAAACCAATTGTCCTCCATCTCGGTGATGACATCCGCTGGAATCACGACCAATACAGCAAGTTCCAAGAT
GTCTTCGAGATCCGCCGGTCCTACAGCATGTCTCGGCCGGAGTTTATCCGAGCCCTGAAAGAGCGCCAATTCGGC
GATTTCTTCGCCATCTACCGCCCATTCTGGAATACCGGCGGCGAGATGGGGAACTGGGATGAGGAGCTCATCTCA
CTGCTACCAGACTCTTGCAAGGTCTACGCCAGTGCAGGTGCTGGATTTGACTGGGTTGATACCGCAGCTTTGGCG
AAGAAGGGTGTGTATACAACAAAGCGATCGGGAAGCTGCATATAGGAGAAATAGCTAACAGCTTCATTGTATAGG
GGTGGTTTACTGCAATGCTGCAGCAGCATGCACAGAATCCGTCGCCGACGCCGCAATCTGGCTCATAATCTCCAC
ATTCCGCCTGTTCTCTTGGTCACACATTGCCGCACGCGCACTGGATGTCGATGCATTTGTCGACGCAAACCGCAA
CCTGGCGATGGTCTCACACAACCCCAATGGACACACACTTGGAATCATTGGCTTCGGCCAGATCGGCCGGCGCAC
TGCCGAGAAGGCGTTCCTGGCCTTGAACATGAAGATTCACTATTACGACATCGTGCAGATGCCCGCACAGCTGGA
AGCCGTCTCGAAGGCAACATACCATAAGACCATGGACAGTCTCCTTGCTGTTTCAGACTGTGTCATGGTTGCAAC
GCCGTTTAGCGGGGAGACACTCCTCAATGCATCTCTGCTGGCAAAGATGAAGGACGGCTCGCGACTGATTAATAT
CGCCCGTGGCAAGTTGCTCGATGAGAGTGCCCTTGTTGACGCACTGAAGAGTGGTAAGCTTGCTGCTGCGGGCTT
GGATGTGCACTACAATGAGCCACGCGTCAGCCCGGAGCTTGCAAGCATGAAGAATGTTGAGATGATGTCGCACAA
TGCTGGTGCTTCAGTGGACTCACATATCGGATTTGAGAGGTTGGGTATGGAGAATATTACTGCTTTCTATCAAAC
TGGAAAGGCTGTTACGCCTGTCAATGCGCACCTAGTCGCCAAAGCGACAGGCTCAAAGCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail