Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9556.t1
Gene name
Locationscaffold_51:24008..26721
Strand-
Gene length (bp)2713
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 9.1E-42 55 436

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 87 106 19
3 133 155 22
4 159 181 22
5 193 215 22
6 230 252 22
7 265 287 22
8 307 326 19
9 347 369 22
10 379 401 22
11 414 436 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 9.06 3.69 14.42
5d_25C Five days - 25 degrees Celsius 13.08 5.99 20.17
7d_25C Seven days - 25 degrees Celsius 16.44 7.96 24.93
10d_25C Ten days - 25 degrees Celsius 19.40 9.78 29.02
7d_15C Seven days - 15 degrees Celsius 7.58 2.91 12.25
7d_30C Seven days - 30 degrees Celsius 14.95 7.08 22.83

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.271239 no
3d_25C 7d_25C 0.049197 yes
3d_25C 7d_15C 0.676822 no
3d_25C 7d_30C 0.098604 no
3d_25C 10d_25C 0.008469 yes
5d_25C 7d_25C 0.513242 no
5d_25C 7d_15C 0.083951 no
5d_25C 7d_30C 0.735537 no
5d_25C 10d_25C 0.180075 no
7d_25C 7d_15C 0.010735 yes
7d_25C 7d_30C 0.817182 no
7d_25C 10d_25C 0.640378 no
7d_15C 7d_30C 0.024170 yes
7d_15C 10d_25C 0.001804 yes
7d_30C 10d_25C 0.404858 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9556.t1
MSPSHSALDFDSNEKSPYINPADLMSDPEKFEVPKVRQDAFGDEEFAEVKYKVLRWWQCGLLMVAETVSLGVLSL
PAAVAALGLLPAILVLVFLGLMATYTGYVIGQMKWRYPHICTFADAGEVIAGKWGREFLGAAQIVFFIFIMASHL
LTFTVAMNTITNHGTCSIVFGIVGMVISFICSLPRTLEKMSWLSIVSFVSIMTSVIIVMIAVGITAPGQGVVAVV
DTNLYHGFSAVCNIVFAFCGHAAFFGLMAELRNPKDFTKSLCLLQGIDMGLYITAALVIYRYAGDDVTSPALGSA
SPMVAKIAYGISLPTIIIAGVINGHVAFKYVYLRVFEGTDRMHKRDWIATGSWVGIALALWTMAWIISAAIPVFS
NLLSLITALFASWFTYGLSGIFWLFMNKGLWFSSPRKIALTLLNIVVISVGAALCGLGLWVSGKALHDNPSIQGT
VSTYDEACSFCDDTDGSEINLQRDQKREPPKPDDQIFKDFTHSKDSKITPSATRIPDGG*
Coding >Pro_DTO377G3_2|g9556.t1
ATGAGCCCCTCGCATTCTGCATTGGATTTCGATTCCAATGAGAAGAGTCCCTATATAAATCCCGCGGACTTGATG
TCTGATCCGGAGAAGTTTGAGGTCCCGAAAGTCAGACAAGATGCCTTTGGCGACGAGGAGTTCGCGGAGGTCAAG
TACAAAGTACTCAGGTGGTGGCAATGTGGTCTGCTGATGGTTGCTGAAACGGTATCACTGGGTGTGCTCTCACTG
CCCGCCGCTGTGGCAGCTCTGGGACTACTTCCAGCGATCCTCGTCTTGGTCTTCCTAGGTTTAATGGCCACATAC
ACCGGCTATGTGATCGGTCAGATGAAATGGAGATATCCACACATCTGCACGTTTGCAGACGCCGGTGAGGTTATA
GCAGGGAAATGGGGACGGGAATTCCTCGGCGCTGCACAGATCGTGTTCTTCATCTTTATCATGGCCAGCCACCTG
TTGACCTTCACCGTTGCCATGAACACCATCACAAACCACGGCACCTGCTCCATCGTCTTTGGCATCGTTGGCATG
GTCATCTCATTCATCTGCTCGTTACCTCGCACTCTGGAAAAGATGTCATGGCTATCCATCGTTTCATTCGTAAGC
ATCATGACATCAGTCATAATTGTCATGATCGCCGTCGGCATCACAGCACCCGGACAGGGAGTTGTCGCAGTCGTC
GACACAAACCTCTACCACGGCTTCTCAGCAGTCTGCAATATCGTCTTCGCTTTCTGCGGCCACGCGGCCTTCTTC
GGCCTAATGGCCGAGCTCAGGAACCCAAAAGACTTCACAAAATCCCTCTGTCTCCTGCAAGGCATCGACATGGGC
CTGTACATCACCGCCGCGTTAGTAATCTACCGGTACGCCGGCGACGACGTGACTTCGCCAGCACTGGGCTCCGCC
TCGCCGATGGTCGCGAAAATCGCGTACGGCATCTCGCTGCCGACTATCATCATCGCCGGTGTCATCAACGGCCAC
GTCGCGTTCAAGTATGTCTACCTGCGTGTTTTCGAGGGTACGGACCGCATGCACAAGCGTGACTGGATCGCTACG
GGCTCGTGGGTCGGTATTGCGCTTGCGCTGTGGACCATGGCGTGGATTATTTCCGCTGCGATTCCCGTGTTTAGT
AACCTGCTCAGCTTGATCACGGCGCTCTTTGCTAGTTGGTTTACGTATGGCTTGAGTGGGATCTTTTGGTTGTTT
ATGAATAAGGGTCTGTGGTTCTCGTCGCCGAGGAAGATTGCCCTCACTTTGTTGAATATCGTTGTTATTTCTGTT
GGTGCTGCGTTGTGCGGTCTTGGTCTTTGGGTCTCGGGCAAAGCTCTCCATGATAACCCTAGCATTCAAGGCACT
GTAAGCACATATGATGAAGCTTGCTCATTTTGTGACGACACTGACGGTTCTGAAATCAATCTTCAACGAGACCAA
AAGAGAGAGCCCCCGAAGCCAGATGATCAGATATTCAAGGATTTCACGCATTCAAAGGATAGCAAGATTACGCCG
TCGGCAACCCGAATTCCAGATGGAGGTTAG
Transcript >Pro_DTO377G3_2|g9556.t1
ATGAGCCCCTCGCATTCTGCATTGGATTTCGATTCCAATGAGAAGAGTCCCTATATAAATCCCGCGGACTTGATG
TCTGATCCGGAGAAGTTTGAGGTCCCGAAAGTCAGACAAGATGCCTTTGGCGACGAGGAGTTCGCGGAGGTCAAG
TACAAAGTACTCAGGTGGTGGCAATGTGGTCTGCTGATGGTTGCTGAAACGGTATCACTGGGTGTGCTCTCACTG
CCCGCCGCTGTGGCAGCTCTGGGACTACTTCCAGCGATCCTCGTCTTGGTCTTCCTAGGTTTAATGGCCACATAC
ACCGGCTATGTGATCGGTCAGATGAAATGGAGATATCCACACATCTGCACGTTTGCAGACGCCGGTGAGGTTATA
GCAGGGAAATGGGGACGGGAATTCCTCGGCGCTGCACAGATCGTGTTCTTCATCTTTATCATGGCCAGCCACCTG
TTGACCTTCACCGTTGCCATGAACACCATCACAAACCACGGCACCTGCTCCATCGTCTTTGGCATCGTTGGCATG
GTCATCTCATTCATCTGCTCGTTACCTCGCACTCTGGAAAAGATGTCATGGCTATCCATCGTTTCATTCGTAAGC
ATCATGACATCAGTCATAATTGTCATGATCGCCGTCGGCATCACAGCACCCGGACAGGGAGTTGTCGCAGTCGTC
GACACAAACCTCTACCACGGCTTCTCAGCAGTCTGCAATATCGTCTTCGCTTTCTGCGGCCACGCGGCCTTCTTC
GGCCTAATGGCCGAGCTCAGGAACCCAAAAGACTTCACAAAATCCCTCTGTCTCCTGCAAGGCATCGACATGGGC
CTGTACATCACCGCCGCGTTAGTAATCTACCGGTACGCCGGCGACGACGTGACTTCGCCAGCACTGGGCTCCGCC
TCGCCGATGGTCGCGAAAATCGCGTACGGCATCTCGCTGCCGACTATCATCATCGCCGGTGTCATCAACGGCCAC
GTCGCGTTCAAGTATGTCTACCTGCGTGTTTTCGAGGGTACGGACCGCATGCACAAGCGTGACTGGATCGCTACG
GGCTCGTGGGTCGGTATTGCGCTTGCGCTGTGGACCATGGCGTGGATTATTTCCGCTGCGATTCCCGTGTTTAGT
AACCTGCTCAGCTTGATCACGGCGCTCTTTGCTAGTTGGTTTACGTATGGCTTGAGTGGGATCTTTTGGTTGTTT
ATGAATAAGGGTCTGTGGTTCTCGTCGCCGAGGAAGATTGCCCTCACTTTGTTGAATATCGTTGTTATTTCTGTT
GGTGCTGCGTTGTGCGGTCTTGGTCTTTGGGTCTCGGGCAAAGCTCTCCATGATAACCCTAGCATTCAAGGCACT
GTAAGCACATATGATGAAGCTTGCTCATTTTGTGACGACACTGACGGTTCTGAAATCAATCTTCAACGAGACCAA
AAGAGAGAGCCCCCGAAGCCAGATGATCAGATATTCAAGGATTTCACGCATTCAAAGGATAGCAAGATTACGCCG
TCGGCAACCCGAATTCCAGATGGAGGTTAG
Gene >Pro_DTO377G3_2|g9556.t1
ATGAGCCCCTCGCATTCTGCATTGGATTTCGATTCCAATGAGAAGAGTCCCTATATAAATCCCGCGGACTTGATG
TCTGATCCGGAGAAGTTTGAGGTCCCGAAAGTCAGACAAGATGCCTTTGGCGACGAGGAGTTCGCGGAGGTCAAG
TACAAAGTACTCAGGTGGTGGTATGTTTCATAGCTCGAAGTGGTAGCTCTGTTATTAACGTATATCTTGTTAGGC
AATGTGGTCTGCGTATGTGATAATATGCTATATCAAACCAACCCTAATCTAACATTCTATTAGTGATGGTTGCTG
AAACGGTATCACTGGGTGTGCTCTCACTGCCCGCCGCTGTGGCAGCTCTGGGACTACTTCCGTAAGCATACCTTC
TGCCTCAAGTGCAGGAATTGAAGCTAATCATATCCAGAGCGATCCTCGTCTTGGTCTTCCTAGGTTTAATGGCCA
CATACACCGGCTATGTGATCGGTCAGATGAAATGGAGATATCCACACATCTGCACGTTTGCAGACGCCGGTGAGG
TTATAGCAGGGAAATGGGGACGGGAATTCCTCGGCGCTGCACAGATCGTGTTCTTCATCTTTATCATGGCCAGCC
ACCTGTTGACCTTCACCGTTGCCATGAACACCATCACAAACCACGGCACCTGCTCCATCGTCTTTGGCATCGTTG
GCATGGTCATCTCATTCATCTGCTCGTTACCTCGCACTCTGGAAAAGATGTCATGGCTATCCATCGTTTGTACGT
TTCCATACACCCCATTGAGAACCCAATTAACAATCCCAGCATTCGTAAGCATCATGACATCAGTCATAATTGTCA
TGATCGCCGTCGGCATCACAGCACCCGGACAGGGAGTTGTCGCAGTCGTCGACACAAACCTCTACCACGGCTTCT
CAGCAGTCTGCAATATCGTCTTCGCTTTCTGCGGCCACGCGGCCTTCTTCGGCCTAATGGCCGAGCTCAGGAACC
CAAAAGACTTCACAAAATCCCTCTGTCTCCTGCAAGGCATCGACATGGGCCTGTACATCACCGCCGCGTTAGTAA
TCTACCGGTACGCCGGCGACGACGTGACTTCGCCAGCACTGGGCTCCGCCTCGCCGATGGTCGCGAAAATCGCGT
ACGGCATCTCGCTGCCGACTATCATCATCGCCGGTGTCATCAACGGCCACGTCGCGTTCAAGTATGTCTACCTGC
GTGTTTTCGAGGGTACGGACCGCATGCACAAGCGTGACTGGATCGCTACGGGCTCGTGGGTCGGTATTGCGCTTG
CGCTGTGGACCATGGCGTGGATTATTTCCGCTGCGATTCCCGTGTTTAGTAACCTGCTCAGCTTGATCACGGCGC
TCTTTGCTAGTTGGTTTACGTATGGCTTGAGTGGGATCTTTTGGTTGTTTATGAATAAGGGTCTGTGGTTCTCGT
CGCCGAGGAAGATTGCCCTCACTTTGTTGAATATCGTTGTTATTTCTGTTGGTGCTGCGTTGTGCGGTCTTGGTC
TTTGGGTCTCGGGCAAAGCTCTCCATGATAACCCTAGCAGTGAGAGCTTTTCTTGTGGGAATAATGCTTAGCTGC
ATGCGTTTTCTGTTGGGTTAGCCTGGTTTATATAAAAGTGTATCTGGGAAGGGGTTTCTGGCGTTCTGGTTTTGC
ATCTGGGGCATCTGTTTTGACACTTTCGATACCTTGTTTCGATCTCGAGTTGCTGCTTGAGTTGGCTTTGCCTTG
GATACTTGTTTCATACACACACTATAGTGGTGTTTGGAGATAGAGGTGAACTAATATAATAATACATAGTTTTAG
TTTCTGACCCTGTAGCAGTTATAAGGCTGAACTCGCGCAGGCGATCAAGCAGACATAGGTTACAGGTTTATTTCA
GTCAAGCATGCGTTCGCGAATGTGCGTTATATAACCGCAGTCTTGTGTGGGAGCATACCGACCCGGCTGAAGCTT
GGAACAGGGTTGGGATTGCGCAGACGTGGTAGTCTGTGCTTGTTGGCGGGCAGAGGATTGCTGCTATGGGTATAG
TGATTCGTATTTCATATTCTGTGAACGCTTTGTTGATTCTGTTGTTGCGAGGTGGAACGGAGCCAGGTGGCACTG
CCGAAGGAGTAAAATATGGAGGGTGTATGTGTTGCAGGCACCTTAGAAGGTTGGGGAAGGGAAAGGCTCGGTTTG
TCTTCTCTGCTGGGGGTCAATCGGGGCACCTGGTTTTGATCCTCGGTGTCTCTAAACAGTTCGATTATCGAATGT
GGGAATCCAGCATGGAATTTTCAGATCCTTTCAGTTGCGAACTTCGTCTGAGTGGAGATGAGAAGCGAGTAGTGA
TGAGAGGCTGCCTGTGACAATATATTTTGTCCCTGGGATGGGCCATGGCTGCGAGCACGCTCTGCTAAGAATATT
ACGTTGTAGGATTTGCATGAAAGATGGTAGCTCAGTCAAAATTTCATTTTGAAGTCGGTCTTGATTATCGGATAA
GCCGAAGATCGGGGCTCGTGTTACGCTCACTGCTAACAGTCTGCTAGTTCAAGGCACTGTAAGCACATATGATGA
AGCTTGCTCATTTTGTGACGACACTGACGGTTCTGAAATCAATCTTCAACGAGACCAAAAGAGAGAGCCCCCGAA
GCCAGATGATCAGATATTCAAGGATTTCACGCATTCAAAGGATAGCAAGATTACGCCGTCGGCAACCCGAATTCC
AGATGGAGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail