Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9551.t1
Gene name
Locationscaffold_51:10417..13470
Strand+
Gene length (bp)3053
Transcript length (bp)1986
Coding sequence length (bp)1986
Protein length (aa) 662

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13668 Ferritin_2 Ferritin-like domain 1.5E-07 452 583

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 48 70 22
2 85 107 22
3 114 133 19
4 143 165 22
5 174 196 22
6 206 225 19
7 250 272 22
8 285 307 22
9 314 336 22
10 340 362 22
11 375 397 22
12 412 434 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9551.t1
MERRRPSCSDSLPRSEAQIRLFPEKFDESSTDDRQKLPPVDGGFQAWMFLMACVMLEALIWGFAFAFGVFQKYYH
AHEAFQDSNMVAVVGTCATGISYLSCPLVIIAMILLPQWGRWFSSIGVIIMCLSLALGSFSSNITHLVLSQGVGF
GIGGCIAYSPSILYMDEWFVHRRGLAFGITWAGSGVSGIIFPIGLEKLLNRYGFETTLRVISVVVFVLAAPFIYF
HKPRLPVRKTVDYQRLNFRFLTSRIFCVYQLGNIMEALGFFLPGIYLPTYARSIGASDFLSSLTITLLNLASVFG
SVTMGHLADRYHAVTCITISTVGSTLAVFFLWGFATTLPTLFVFSIAYGLFAGCYSATWSGITHEVRRIDPSADA
TIIFSVIAFGRGIGNVVSGPLSEAILEVDPWKGSAAAGYGSGYGLIIFLLLAGVTATSAATTTAAAGAASTCVPS
SSDTTVLQFALGVSNFIGGWYNSTVNSTFGNTNNATLLAYQKILFGLEKDNTLSSAAIEKVGAKAPGFTAPQCTY
VFPEVNTTQTWAQWAYRFEDTVTGAFIGLAGYSDSPEVSFLLARLAAEHSAHSALIGSRVNSTYFAQNTTSLVAA
YGPAQILSTRNQTGSLGAYLGGCLTAPTSPCGTLRIGPLDATPSPSSSGVASTSLAAAKKA*
Coding >Pro_DTO377G3_2|g9551.t1
ATGGAGAGAAGACGCCCTTCATGCAGCGACTCACTGCCTCGCAGTGAAGCACAGATACGCTTGTTCCCCGAGAAA
TTCGACGAATCGTCCACGGACGATAGACAAAAGTTACCACCTGTCGACGGAGGTTTCCAGGCATGGATGTTCCTG
ATGGCTTGTGTAATGTTGGAGGCTTTGATATGGGGATTTGCTTTTGCATTCGGAGTCTTTCAGAAATACTATCAC
GCCCATGAAGCCTTCCAGGACTCTAACATGGTAGCTGTTGTTGGAACATGTGCTACAGGAATATCCTATTTGAGC
TGTCCACTAGTCATTATTGCTATGATCCTTCTTCCTCAATGGGGACGCTGGTTCTCATCTATAGGAGTGATAATA
ATGTGTCTTTCCCTAGCACTGGGTTCATTTTCTTCCAATATCACTCACCTAGTCCTCTCCCAAGGAGTCGGCTTC
GGCATCGGCGGGTGTATAGCATACAGTCCATCCATCCTGTACATGGACGAATGGTTCGTCCACCGACGAGGACTC
GCGTTCGGCATAACCTGGGCTGGCTCAGGAGTATCCGGGATCATATTCCCGATTGGGTTAGAGAAGCTATTGAAT
CGCTACGGATTCGAAACGACTCTTAGGGTCATCTCCGTGGTGGTGTTCGTTCTCGCTGCACCTTTTATCTACTTT
CACAAACCCCGGCTTCCGGTCAGAAAAACAGTCGACTATCAACGTCTGAACTTCCGCTTCCTTACCAGCAGGATA
TTTTGCGTCTACCAACTCGGCAACATCATGGAGGCATTGGGGTTCTTCTTGCCCGGAATTTATCTGCCGACTTAT
GCCCGTAGCATCGGCGCCTCGGATTTTCTCTCCTCGCTGACCATCACGCTTTTGAATCTGGCGTCGGTTTTCGGG
AGTGTTACTATGGGCCATCTGGCGGATCGATACCATGCTGTCACCTGCATTACCATCTCGACTGTCGGCAGTACA
CTGGCTGTATTCTTCCTCTGGGGATTTGCGACAACCCTGCCCACATTGTTCGTCTTTTCGATCGCATACGGTTTG
TTTGCAGGCTGTTACTCGGCGACATGGTCGGGGATAACTCACGAGGTCCGACGGATCGACCCGTCCGCCGACGCA
ACCATCATCTTCTCGGTTATTGCCTTTGGACGAGGAATTGGAAATGTCGTCAGCGGCCCCTTGAGCGAGGCTATA
CTCGAGGTAGATCCGTGGAAGGGCTCCGCAGCAGCGGGCTATGGCAGTGGATATGGGCTGATCATCTTCCTCCTC
CTGGCCGGAGTCACCGCCACCTCGGCCGCCACTACTACTGCTGCCGCAGGCGCAGCCTCAACCTGCGTGCCCTCA
TCTTCTGATACCACTGTCCTCCAATTCGCCCTAGGAGTCTCCAACTTCATCGGCGGCTGGTACAACTCGACCGTG
AACAGCACCTTCGGCAACACCAACAACGCCACCCTTCTAGCTTATCAGAAGATCCTCTTCGGCCTGGAGAAGGAC
AACACGCTATCCAGCGCCGCCATCGAGAAAGTCGGCGCCAAGGCCCCCGGCTTCACCGCGCCCCAGTGCACCTAC
GTTTTCCCCGAGGTGAACACCACCCAGACCTGGGCACAGTGGGCCTACCGCTTCGAAGACACCGTCACTGGTGCC
TTCATCGGTCTTGCCGGCTATTCCGACTCCCCCGAGGTCTCCTTCCTCCTGGCTCGTCTGGCTGCTGAGCACAGC
GCGCACTCTGCTTTGATTGGCAGCCGTGTGAACTCTACCTACTTTGCCCAGAACACTACTTCTCTGGTGGCGGCT
TACGGCCCGGCTCAGATCTTGTCTACTCGTAACCAGACTGGTAGCCTTGGCGCGTATCTGGGTGGTTGTCTTACT
GCCCCTACTAGCCCTTGTGGCACGCTGAGAATCGGACCTTTGGATGCTACTCCCTCTCCTTCCTCTTCCGGTGTG
GCGAGCACCAGCTTGGCTGCTGCCAAGAAGGCTTAG
Transcript >Pro_DTO377G3_2|g9551.t1
ATGGAGAGAAGACGCCCTTCATGCAGCGACTCACTGCCTCGCAGTGAAGCACAGATACGCTTGTTCCCCGAGAAA
TTCGACGAATCGTCCACGGACGATAGACAAAAGTTACCACCTGTCGACGGAGGTTTCCAGGCATGGATGTTCCTG
ATGGCTTGTGTAATGTTGGAGGCTTTGATATGGGGATTTGCTTTTGCATTCGGAGTCTTTCAGAAATACTATCAC
GCCCATGAAGCCTTCCAGGACTCTAACATGGTAGCTGTTGTTGGAACATGTGCTACAGGAATATCCTATTTGAGC
TGTCCACTAGTCATTATTGCTATGATCCTTCTTCCTCAATGGGGACGCTGGTTCTCATCTATAGGAGTGATAATA
ATGTGTCTTTCCCTAGCACTGGGTTCATTTTCTTCCAATATCACTCACCTAGTCCTCTCCCAAGGAGTCGGCTTC
GGCATCGGCGGGTGTATAGCATACAGTCCATCCATCCTGTACATGGACGAATGGTTCGTCCACCGACGAGGACTC
GCGTTCGGCATAACCTGGGCTGGCTCAGGAGTATCCGGGATCATATTCCCGATTGGGTTAGAGAAGCTATTGAAT
CGCTACGGATTCGAAACGACTCTTAGGGTCATCTCCGTGGTGGTGTTCGTTCTCGCTGCACCTTTTATCTACTTT
CACAAACCCCGGCTTCCGGTCAGAAAAACAGTCGACTATCAACGTCTGAACTTCCGCTTCCTTACCAGCAGGATA
TTTTGCGTCTACCAACTCGGCAACATCATGGAGGCATTGGGGTTCTTCTTGCCCGGAATTTATCTGCCGACTTAT
GCCCGTAGCATCGGCGCCTCGGATTTTCTCTCCTCGCTGACCATCACGCTTTTGAATCTGGCGTCGGTTTTCGGG
AGTGTTACTATGGGCCATCTGGCGGATCGATACCATGCTGTCACCTGCATTACCATCTCGACTGTCGGCAGTACA
CTGGCTGTATTCTTCCTCTGGGGATTTGCGACAACCCTGCCCACATTGTTCGTCTTTTCGATCGCATACGGTTTG
TTTGCAGGCTGTTACTCGGCGACATGGTCGGGGATAACTCACGAGGTCCGACGGATCGACCCGTCCGCCGACGCA
ACCATCATCTTCTCGGTTATTGCCTTTGGACGAGGAATTGGAAATGTCGTCAGCGGCCCCTTGAGCGAGGCTATA
CTCGAGGTAGATCCGTGGAAGGGCTCCGCAGCAGCGGGCTATGGCAGTGGATATGGGCTGATCATCTTCCTCCTC
CTGGCCGGAGTCACCGCCACCTCGGCCGCCACTACTACTGCTGCCGCAGGCGCAGCCTCAACCTGCGTGCCCTCA
TCTTCTGATACCACTGTCCTCCAATTCGCCCTAGGAGTCTCCAACTTCATCGGCGGCTGGTACAACTCGACCGTG
AACAGCACCTTCGGCAACACCAACAACGCCACCCTTCTAGCTTATCAGAAGATCCTCTTCGGCCTGGAGAAGGAC
AACACGCTATCCAGCGCCGCCATCGAGAAAGTCGGCGCCAAGGCCCCCGGCTTCACCGCGCCCCAGTGCACCTAC
GTTTTCCCCGAGGTGAACACCACCCAGACCTGGGCACAGTGGGCCTACCGCTTCGAAGACACCGTCACTGGTGCC
TTCATCGGTCTTGCCGGCTATTCCGACTCCCCCGAGGTCTCCTTCCTCCTGGCTCGTCTGGCTGCTGAGCACAGC
GCGCACTCTGCTTTGATTGGCAGCCGTGTGAACTCTACCTACTTTGCCCAGAACACTACTTCTCTGGTGGCGGCT
TACGGCCCGGCTCAGATCTTGTCTACTCGTAACCAGACTGGTAGCCTTGGCGCGTATCTGGGTGGTTGTCTTACT
GCCCCTACTAGCCCTTGTGGCACGCTGAGAATCGGACCTTTGGATGCTACTCCCTCTCCTTCCTCTTCCGGTGTG
GCGAGCACCAGCTTGGCTGCTGCCAAGAAGGCTTAG
Gene >Pro_DTO377G3_2|g9551.t1
ATGGAGAGAAGACGCCCTTCATGCAGCGACTCACTGCCTCGCAGTGAAGCACAGATACGCTTGTTCCCCGAGAAA
TTCGACGAATCGTCCACGGACGATAGACAAAAGTTACCACCTGTCGACGGAGGTTTCCAGGCATGGATGTTCCTG
ATGGCTTGTGTAATGTTGGAGGCTTTGATATGGGGTAAGTCAGCTTGCACGACTCTAGGAGATGACAGCCGACTA
ACATGAGCAGGATTTGCTTTTGCATTCGGAGTCTTTCAGAAATACTATCACGCCCATGAAGCCTTCCAGGACTCT
AACATGGTAGCTGTTGTTGGAACATGTGCTACAGTGAGATCACCAACTGCTTACGACGGTCTATGCTAACACAAT
CGACAGGGAATATCCTATTTGAGCTGTCCACTAGTCATTATTGCTATGATCCTTCTTCCTCAATGGGGACGCTGG
TTCTCATCTATAGGAGTGATAATAATGTGTCTTTCCCTAGCACTGGGTTCATTTTCTTCCAATATCACTCACCTA
GTCCTCTCCCAAGGAGTCGGCTTCGGCATCGGCGGGTGTATAGCATACAGTCCATCCATCCTGTACATGGACGAA
TGGTTCGTCCACCGACGAGGACTCGCGTTCGGCATAACCTGGGCTGGCTCAGGAGTATCCGGGATCATATTCCCG
ATTGGGTTAGAGAAGCTATTGAATCGCTACGGATTCGAAACGACTCTTAGGGTCATCTCCGTGGTGGTGTTCGTT
CTCGCTGCACCTTTTATCTACTTTCACAAACCCCGGCTTCCGGTCAGAAAAACAGTCGACTATCAACGTCTGAAC
TTCCGCTTCCTTACCAGCAGGATATTTTGCGTCTACCAACTCGGCAACATCATGGAGGCATTGGGGTTCTTCTTG
CCCGGAATTTATCTGCCGACTTATGCCCGTAGCATCGGCGCCTCGGATTTTCTCTCCTCGCTGACCATCACGCTT
TTGAATCTGGCGTCGGTTTTCGGGAGTGTTACTATGGGCCATCTGGCGGATCGATACCATGCTGTCACCTGCATT
ACCATCTCGACTGTCGGCAGTACACTGGCTGTATTCTTCCTCTGGGGATTTGCGACAACCCTGCCCACATTGTTC
GTCTTTTCGATCGCATACGGTTTGTTTGCAGGCTGTTACTCGGCGACATGGTCGGGGATAACTCACGAGGTCCGA
CGGATCGACCCGTCCGCCGACGCAACCATCATCTTCTCGGTTATTGCCTTTGGACGAGGAATTGGAAATGTCGTC
AGCGGCCCCTTGAGCGAGGCTATACTCGAGGTAGATCCGTGGAAGGGCTCCGCAGCAGCGGGCTATGGCAGTGGA
TATGGGCTGATCATCTTGTGTACGGGGATCAGCTGCTTGTTGAGCGGAGTATGTATAGTGGCGCATTATATGAGA
TGTATATAGGCGGGTCTCGTTGCACATTTATGCTGATGATTAACGTCTGCTTTTGGTGGGACAAAGGATGGTTAA
GATCGCTACATATGCTACTGTTTCGAACTGATGGGCTGCCAGTCTATCAGTTATTTTCTTTTCCCTTTGAGCATG
ACCCCTCTATGTTCAATTCCAATTTATTTTATGCATAGCTCGATTTATACAAATCTCGGAAAGGCTTGGGATTTC
CCTGAAAAGTTAAATTGCGATATTTATAGCGGTCCGCCAGCATCCGGGTGCGAAGGAGTATATCATTCTACTCGC
CACCATGATTGCTAGACATTTCCATGCCGATATTCAGGGACTATAATGCTAGTAGGTCGTAGATTTAAGATCAGA
ACTAGTCATGTAAGCTTTAATTCTATGCAACAGTCAAAGTTTTATCGACGCCATCATCCAAGTCACCGGGGTCGA
CCGGGTACCCTGATGATCTCACCCACTCCATTTTGGATCTTGAATCTCCAAGCGTCGATCTCTATACTCTTTTAT
ATCAAAATCATGGCCCAAGCTTGGCCTGCTCAGTGGTCGACGTCATCCCACAAGGCTACGGCAATATGGATTCCA
CCACACCCTGCTCTCACAGGTTGATATTGTGGACCATGACGCCAATCCAGAGGAAACAACCGGTTCTTCAGGAAG
TATACTTCAATTAACATACTCGGAGGCTGCCGCATGCGTTGCGGGGGCGATCATGACTCTAGAAGACTCGGAGAT
TGCGCGGTTTTATGGGCTATAAGGGTATTTAACTACCCATGCACGTAGCTAGTCTTCTGTTCTTCACAAAACCTT
ACCTAGTCACTCTATAAGCTACCTCTATAAGCCTCCTCTTCAGAGACCAGATTACTCCAAGCGCAATGCGTCTCA
ACATCGTCAGCCTCCTCCTGGCCGGAGTCACCGCCACCTCGGCCGCCACTACTACTGCTGCCGCAGGCGCAGCCT
CAACCTGCGTGCCCTCATCTTCTGATACCACTGTCCTCCAATTCGCCCTAGGAGTCTCCAACTTCATCGGCGGCT
GGTACAACTCGACCGTGAACAGCACCTTCGGCAACACCAACAACGCCACCCTTCTAGCTTATCAGAAGATCCTCT
TCGGCCTGGAGAAGGACAACACGCTATCCAGCGCCGCCATCGAGAAAGTCGGCGCCAAGGCCCCCGGCTTCACCG
CGCCCCAGTGCACCTACGTTTTCCCCGAGGTGAACACCACCCAGACCTGGGCACAGTGGGCCTACCGCTTCGAAG
ACACCGTCACTGGTGCCTTCATCGGTCTTGCCGGCTATTCCGACTCCCCCGAGGTCTCCTTCCTCCTGGCTCGTC
TGGCTGCTGAGCACAGCGCGCACTCTGCTTTGATTGGCAGCCGTGTGAACTCTACCTACTTTGCCCAGAACACTA
CTTCTCTGGTGGCGGCTTACGGCCCGGCTCAGATCTTGTCTACTCGTAACCAGACTGGTAGCCTTGGCGCGTATC
TGGGTGGTTGTCTTACTGCCCCTACTAGCCCTTGTGGCACGCTGAGAATCGGACCTTTGGATGCTACTCCCTCTC
CTTCCTCTTCCGGTGTGGCGAGCACCAGCTTGGCTGCTGCCAAGAAGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail