Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9523.t1
Gene name
Locationscaffold_50:19737..21830
Strand+
Gene length (bp)2093
Transcript length (bp)1860
Coding sequence length (bp)1860
Protein length (aa) 620

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1 6.8E-71 161 613

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2.09 0.50 3.67
5d_25C Five days - 25 degrees Celsius 1.75 0.36 3.14
7d_25C Seven days - 25 degrees Celsius 1.11 0.15 2.08
10d_25C Ten days - 25 degrees Celsius 1.37 0.23 2.51
7d_15C Seven days - 15 degrees Celsius 2.76 0.77 4.76
7d_30C Seven days - 30 degrees Celsius 3.96 1.24 6.68

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.757578 no
3d_25C 7d_25C 0.184958 no
3d_25C 7d_15C 0.569403 no
3d_25C 7d_30C 0.102709 no
3d_25C 10d_25C 0.367957 no
5d_25C 7d_25C 0.396238 no
5d_25C 7d_15C 0.328713 no
5d_25C 7d_30C 0.038966 yes
5d_25C 10d_25C 0.667404 no
7d_25C 7d_15C 0.047134 yes
7d_25C 7d_30C 0.004450 yes
7d_25C 10d_25C 0.738815 no
7d_15C 7d_30C 0.420514 no
7d_15C 10d_25C 0.094431 no
7d_30C 10d_25C 0.007091 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9523.t1
MRLPFISLAALAVAIQAQEVYLTTTGYSARPQCTQSNVAPKYQFQPFSYTLNETVRYATSVPSPTTTRTYGPRYT
DAVKHFTTSWSTSTWGSWVPGQTVISATDTKDPYGQAAWSSMWLQADLHNYTTTGLFSTTVSPTPVPSSELVLPP
RDYFGPTDCYNFPKDFVFGVAGSAAQIEGAIGLDGRSPSLLEKLVPDSKPKDYVTNENYFLYKQDIQRLAAMGVE
YYSFTIPWTRVLPFALPGTPVNQQAIDHYNDLIDTVLDAGMTPAVTMLHFDSPLMFVASDNITRHPDIGYNNAGY
QNETFVDAFVNYGKVLLSHYADRVPIWVTFNEPLLYAFNFKGADHVVKAHSQIYHFYHDTLKATGKIGIKFNDNF
GVPKDPKNSSHVLAADRFQEMQLGIFANPIFLGKQYPKSVLETLPGAKPLSKSELKYIGHTSDFFGIDPYTATVV
SPAEEGIKACAANPSISNDLFPYCVKQETKNVYGWNIGYRSESYVYITPTYLREYLYYLWNTFRHPILVSEFGFP
VHAEAELELSDQLFDSPRSVYYLSYMSEILKSIYEDGVHVMGALAWSFVDNWEFGDYTQQFGIQSVNRTTQQRHY
KKSFFDLVDFVKTRQPNKD*
Coding >Pro_DTO377G3_2|g9523.t1
ATGCGATTGCCGTTCATTTCCCTTGCTGCTTTGGCTGTGGCTATACAGGCACAGGAAGTATACTTGACAACAACA
GGTTATTCTGCTCGGCCACAATGTACACAATCGAACGTGGCACCGAAATACCAATTTCAGCCCTTCTCCTATACT
TTGAACGAAACAGTTCGATACGCAACCTCTGTTCCTTCCCCGACGACCACACGGACATATGGCCCACGTTATACA
GACGCAGTCAAACATTTTACCACTAGCTGGTCGACCTCAACGTGGGGCAGCTGGGTTCCGGGGCAAACTGTTATC
AGCGCCACTGACACAAAGGACCCATATGGACAAGCTGCGTGGTCTTCGATGTGGCTACAGGCAGATCTTCACAAC
TATACCACCACTGGGTTATTCTCGACAACTGTCAGTCCCACACCCGTGCCCAGCAGTGAGCTGGTCTTGCCACCG
CGCGACTATTTTGGTCCTACCGACTGCTATAATTTCCCCAAGGACTTTGTGTTTGGGGTTGCAGGGAGTGCGGCG
CAGATTGAAGGTGCAATTGGGTTGGATGGTCGATCACCTTCGTTGTTGGAGAAATTGGTACCCGACAGCAAGCCA
AAGGACTATGTCACCAACGAAAATTATTTCTTGTATAAGCAAGACATACAGCGACTAGCTGCAATGGGTGTCGAG
TATTATAGCTTTACAATCCCCTGGACGCGGGTTTTGCCTTTTGCTCTTCCAGGAACACCTGTCAATCAACAAGCC
ATTGATCATTATAATGACTTGATCGACACAGTTCTCGATGCAGGAATGACGCCAGCTGTCACAATGCTTCATTTC
GACAGCCCATTAATGTTTGTCGCCAGCGACAATATCACGCGACACCCAGATATTGGCTACAACAATGCCGGCTAC
CAAAACGAAACTTTTGTCGACGCATTTGTCAACTATGGAAAGGTTCTGCTTTCTCATTATGCAGACCGAGTCCCA
ATCTGGGTGACCTTCAATGAGCCCCTGCTCTACGCATTCAATTTCAAAGGAGCAGACCACGTTGTCAAGGCACAT
TCCCAGATCTACCACTTCTATCATGATACCTTGAAGGCCACGGGGAAGATTGGCATAAAGTTCAACGACAACTTT
GGAGTGCCTAAGGATCCGAAAAACTCTAGCCATGTCCTCGCGGCTGACCGCTTCCAAGAAATGCAACTGGGTATC
TTCGCAAATCCAATATTCTTGGGTAAGCAGTACCCAAAGTCTGTATTAGAAACACTCCCCGGAGCCAAACCCTTG
AGCAAATCCGAACTGAAATACATCGGCCACACATCCGACTTTTTTGGTATTGATCCGTATACCGCTACGGTAGTA
TCTCCGGCCGAGGAAGGCATCAAGGCTTGCGCTGCCAACCCGTCAATCTCGAATGATCTTTTCCCATATTGCGTC
AAGCAAGAAACAAAGAATGTTTACGGATGGAACATTGGGTATCGCTCCGAGTCCTACGTGTATATCACACCGACG
TATCTCCGAGAGTATCTCTATTACCTGTGGAATACTTTCCGACACCCAATTCTGGTATCAGAGTTTGGGTTTCCG
GTACATGCAGAAGCAGAACTGGAGCTCTCTGACCAGCTATTTGACTCTCCTAGGAGCGTGTACTATCTTTCCTAC
ATGTCTGAAATTCTCAAGTCAATATATGAAGACGGTGTGCATGTCATGGGAGCCCTTGCTTGGAGCTTCGTCGAC
AATTGGGAATTTGGGGACTACACGCAACAATTTGGCATTCAAAGTGTCAATCGCACCACCCAGCAGCGGCACTAC
AAAAAGAGCTTCTTTGACCTGGTTGATTTTGTGAAAACTCGACAGCCGAACAAAGACTAA
Transcript >Pro_DTO377G3_2|g9523.t1
ATGCGATTGCCGTTCATTTCCCTTGCTGCTTTGGCTGTGGCTATACAGGCACAGGAAGTATACTTGACAACAACA
GGTTATTCTGCTCGGCCACAATGTACACAATCGAACGTGGCACCGAAATACCAATTTCAGCCCTTCTCCTATACT
TTGAACGAAACAGTTCGATACGCAACCTCTGTTCCTTCCCCGACGACCACACGGACATATGGCCCACGTTATACA
GACGCAGTCAAACATTTTACCACTAGCTGGTCGACCTCAACGTGGGGCAGCTGGGTTCCGGGGCAAACTGTTATC
AGCGCCACTGACACAAAGGACCCATATGGACAAGCTGCGTGGTCTTCGATGTGGCTACAGGCAGATCTTCACAAC
TATACCACCACTGGGTTATTCTCGACAACTGTCAGTCCCACACCCGTGCCCAGCAGTGAGCTGGTCTTGCCACCG
CGCGACTATTTTGGTCCTACCGACTGCTATAATTTCCCCAAGGACTTTGTGTTTGGGGTTGCAGGGAGTGCGGCG
CAGATTGAAGGTGCAATTGGGTTGGATGGTCGATCACCTTCGTTGTTGGAGAAATTGGTACCCGACAGCAAGCCA
AAGGACTATGTCACCAACGAAAATTATTTCTTGTATAAGCAAGACATACAGCGACTAGCTGCAATGGGTGTCGAG
TATTATAGCTTTACAATCCCCTGGACGCGGGTTTTGCCTTTTGCTCTTCCAGGAACACCTGTCAATCAACAAGCC
ATTGATCATTATAATGACTTGATCGACACAGTTCTCGATGCAGGAATGACGCCAGCTGTCACAATGCTTCATTTC
GACAGCCCATTAATGTTTGTCGCCAGCGACAATATCACGCGACACCCAGATATTGGCTACAACAATGCCGGCTAC
CAAAACGAAACTTTTGTCGACGCATTTGTCAACTATGGAAAGGTTCTGCTTTCTCATTATGCAGACCGAGTCCCA
ATCTGGGTGACCTTCAATGAGCCCCTGCTCTACGCATTCAATTTCAAAGGAGCAGACCACGTTGTCAAGGCACAT
TCCCAGATCTACCACTTCTATCATGATACCTTGAAGGCCACGGGGAAGATTGGCATAAAGTTCAACGACAACTTT
GGAGTGCCTAAGGATCCGAAAAACTCTAGCCATGTCCTCGCGGCTGACCGCTTCCAAGAAATGCAACTGGGTATC
TTCGCAAATCCAATATTCTTGGGTAAGCAGTACCCAAAGTCTGTATTAGAAACACTCCCCGGAGCCAAACCCTTG
AGCAAATCCGAACTGAAATACATCGGCCACACATCCGACTTTTTTGGTATTGATCCGTATACCGCTACGGTAGTA
TCTCCGGCCGAGGAAGGCATCAAGGCTTGCGCTGCCAACCCGTCAATCTCGAATGATCTTTTCCCATATTGCGTC
AAGCAAGAAACAAAGAATGTTTACGGATGGAACATTGGGTATCGCTCCGAGTCCTACGTGTATATCACACCGACG
TATCTCCGAGAGTATCTCTATTACCTGTGGAATACTTTCCGACACCCAATTCTGGTATCAGAGTTTGGGTTTCCG
GTACATGCAGAAGCAGAACTGGAGCTCTCTGACCAGCTATTTGACTCTCCTAGGAGCGTGTACTATCTTTCCTAC
ATGTCTGAAATTCTCAAGTCAATATATGAAGACGGTGTGCATGTCATGGGAGCCCTTGCTTGGAGCTTCGTCGAC
AATTGGGAATTTGGGGACTACACGCAACAATTTGGCATTCAAAGTGTCAATCGCACCACCCAGCAGCGGCACTAC
AAAAAGAGCTTCTTTGACCTGGTTGATTTTGTGAAAACTCGACAGCCGAACAAAGACTAA
Gene >Pro_DTO377G3_2|g9523.t1
ATGCGATTGCCGTTCATTTCCCTTGCTGCTTTGGCTGTGGCTATACAGGCACAGGAAGTATACTTGACAACAACA
GGTTATTCTGCTCGGCCACAATGTACACAATCGAACGTGGCACCGAAATACCAATTTCAGCCCTTCTCCTATACT
TTGAACGAAACAGTTCGGTAAGAAATTTATAGAACTAGTGTACACCATCGCTTGCTAATTGAAGTATGAGATACG
CAACCTCTGTTCCTTCCCCGACGACCACACGGACATATGGCCCACGTTATACAGACGCAGTCAAACATTTTACCA
CTAGCTGGTCGACCTCAACGTGGGGCAGCTGGGTTCCGGGGCAAACTGTTATCAGCGCCACTGACACAAAGGACC
CATATGGACAAGCTGCGTGGTCTTCGATGTGGCTACAGGCAGATCTTCACAACTATGTATGTCGTGTGCTCTGTG
ATTCCTCGCAAATTGCAGTTGTAGCTTACTTGAGTAGACCACCACTGGGTTATTCTCGACAACTGTCAGTCCCAC
ACCCGTGCCCAGCAGTGAGCTGGTCTTGCCACCGCGCGACTATTTTGGTCCTACCGACTGCTATAATTTCCCCAA
GGACTTTGTGTTTGGGGTTGCAGGGAGTGCGGCGCAGATTGAAGGTGCAATTGGGTTGGATGGTCGATCACCTTC
GTTGTTGGAGAAATTGGTACCCGACAGCAAGCCAAAGGACTATGTCACCAACGAAAATTATTTCTTGTATAAGCA
AGACATACAGCGACTAGCTGCAATGGGTGTCGAGTATTATAGCTTTACAATCCCCTGGACGCGGGTTTTGCCTTT
TGCTCTTCCAGGAACACCTGTCAATCAACAAGCCATTGATCATTATAATGACTTGATCGACACAGTTCTCGATGC
AGGAATGACGGTAAATATCCCAAATATCTCAATTCATACCTGTTAAATGCCAGTATTCTAATAAATTTGCAGCCA
GCTGTCACAATGCTTCATTTCGACAGCCCATTAATGTTTGTCGCCAGCGACAATATCACGCGACACCCAGATATT
GGCTACAACAATGCCGGCTACCAAAACGAAACTTTTGTCGACGCATTTGTCAACTATGGAAAGGTACGGATTCTA
TTCCACAAGTCATCAATTCCCATCCAAGTCTGACGTGGATCACTCCCTAGGTTCTGCTTTCTCATTATGCAGACC
GAGTCCCAATCTGGGTGACCTTCAATGAGCCCCTGCTCTACGCATTCAATTTCAAAGGAGCAGACCACGTTGTCA
AGGCACATTCCCAGATCTACCACTTCTATCATGATACCTTGAAGGCCACGGGGAAGATTGGCATAAAGTTCAACG
ACAACTTTGGAGTGCCTAAGGATCCGAAAAACTCTAGCCATGTCCTCGCGGCTGACCGCTTCCAAGAAATGCAAC
TGGGTATCTTCGCAAATCCAATATTCTTGGGTAAGCAGTACCCAAAGTCTGTATTAGAAACACTCCCCGGAGCCA
AACCCTTGAGCAAATCCGAACTGAAATACATCGGCCACACATCCGACTTTTTTGGTATTGATCCGTATACCGCTA
CGGTAGTATCTCCGGCCGAGGAAGGCATCAAGGCTTGCGCTGCCAACCCGTCAATCTCGAATGATCTTTTCCCAT
ATTGCGTCAAGCAAGAAACAAAGAATGTTTACGGATGGAACATTGGGTATCGCTCCGAGTCCTACGTGTATATCA
CACCGACGTATCTCCGAGAGTATCTCTATTACCTGTGGAATACTTTCCGACACCCAATTCTGGTATCAGAGTTTG
GGTTTCCGGTACATGCAGAAGCAGAACTGGAGCTCTCTGACCAGCTATTTGACTCTCCTAGGAGCGTGTACTATC
TTTCCTACATGTCTGAAATTCTCAAGTCAATATATGAAGACGGTGTGCATGTCATGGGAGCCCTTGCTTGGAGCT
TCGTCGACAATTGGGAATTTGGGGACTACACGCAACAATTTGGCATTCAAAGTGTCAATCGCACCACCCAGCAGC
GGCACTACAAAAAGAGCTTCTTTGACCTGGTTGATTTTGTGAAAACTCGACAGCCGAACAAAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail