Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g951.t1
Gene name
Locationscaffold_01:2522168..2522568
Strand+
Gene length (bp)400
Transcript length (bp)330
Coding sequence length (bp)330
Protein length (aa) 110

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 1.7E-27 7 98
PF13098 Thioredoxin_2 Thioredoxin-like domain 6.7E-08 18 94
PF00578 AhpC-TSA AhpC/TSA family 1.4E-07 18 75
PF13905 Thioredoxin_8 Thioredoxin-like 4.2E-06 19 84
PF14595 Thioredoxin_9 Thioredoxin 1.4E-06 26 102

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0016209 antioxidant activity Yes
GO:0045454 cell redox homeostasis Yes
GO:0008150 biological_process No
GO:0065008 regulation of biological quality No
GO:0009987 cellular process No
GO:0042592 homeostatic process No
GO:0065007 biological regulation No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019725 cellular homeostasis No
GO:0050789 regulation of biological process No
GO:0003674 molecular_function No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g951.t1
MPVIAINSYDEFNQIINSGKPVVIDFWATWCGPCRTISPIFEKMSELAEFNNLEFYKVDADEQERIAQEVGVRSM
PTFYLFKDGFKIKEHVGANPNGLEGLLQVAASGA*
Coding >Pro_DTO377G3_2|g951.t1
ATGCCTGTTATAGCCATCAACTCGTACGACGAATTCAATCAAATCATCAACAGCGGGAAGCCCGTTGTAATCGAC
TTCTGGGCAACATGGTGTGGGCCTTGCCGAACTATATCGCCTATTTTCGAGAAAATGTCGGAGTTGGCGGAGTTC
AACAATCTCGAATTTTACAAAGTTGATGCCGATGAACAAGAACGAATTGCTCAGGAGGTCGGCGTACGTTCAATG
CCAACCTTCTATTTATTTAAAGACGGGTTTAAGATTAAAGAACATGTTGGGGCCAACCCGAATGGTTTGGAAGGG
CTTCTTCAGGTAGCCGCTTCTGGAGCATGA
Transcript >Pro_DTO377G3_2|g951.t1
ATGCCTGTTATAGCCATCAACTCGTACGACGAATTCAATCAAATCATCAACAGCGGGAAGCCCGTTGTAATCGAC
TTCTGGGCAACATGGTGTGGGCCTTGCCGAACTATATCGCCTATTTTCGAGAAAATGTCGGAGTTGGCGGAGTTC
AACAATCTCGAATTTTACAAAGTTGATGCCGATGAACAAGAACGAATTGCTCAGGAGGTCGGCGTACGTTCAATG
CCAACCTTCTATTTATTTAAAGACGGGTTTAAGATTAAAGAACATGTTGGGGCCAACCCGAATGGTTTGGAAGGG
CTTCTTCAGGTAGCCGCTTCTGGAGCATGA
Gene >Pro_DTO377G3_2|g951.t1
ATGCCTGTTATAGCCATCAACTCGTACGTGATGTTACAAACAGTTTCCCCCCTCAGACCATATTGCTCAGTGCTA
ATATTTCCAATATTGTAGGTACGACGAATTCAATCAAATCATCAACAGCGGGAAGCCCGTTGTAATCGACTTCTG
GGCAACATGGTGTGGGCCTTGCCGAACTATATCGCCTATTTTCGAGAAAATGTCGGAGTTGGCGGAGTTCAACAA
TCTCGAATTTTACAAAGTTGATGCCGATGAACAAGAACGAATTGCTCAGGAGGTCGGCGTACGTTCAATGCCAAC
CTTCTATTTATTTAAAGACGGGTTTAAGATTAAAGAACATGTTGGGGCCAACCCGAATGGTTTGGAAGGGCTTCT
TCAGGTAGCCGCTTCTGGAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail