Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9503.t1
Gene name
Locationscaffold_49:50047..55020
Strand+
Gene length (bp)4973
Transcript length (bp)4908
Coding sequence length (bp)4908
Protein length (aa) 1636

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00225 Kinesin Kinesin motor domain 7.5E-110 14 366
PF12473 DUF3694 Kinesin protein 5.2E-44 1179 1327
PF16183 Kinesin_assoc Kinesin-associated 7.6E-31 425 524
PF16796 Microtub_bd Microtubule binding 9.4E-24 7 170
PF12423 KIF1B Kinesin protein 1B 4.6E-07 955 996
PF00498 FHA FHA domain 2.0E-04 535 592

GO

GO Term Description Terminal node
GO:0008017 microtubule binding Yes
GO:0003777 microtubule motor activity Yes
GO:0005524 ATP binding Yes
GO:0005515 protein binding Yes
GO:0007018 microtubule-based movement Yes
GO:0009987 cellular process No
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:0008092 cytoskeletal protein binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0006928 movement of cell or subcellular component No
GO:0015631 tubulin binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0007017 microtubule-based process No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003774 motor activity No
GO:0005488 binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9503.t1
MAPGGGGNIKVVVRVRPFNSREIERGAKCIVSMKGNQTVLTPPPGAEDKSRKGGKGVSEGNKVFAFDRSYWSFDK
KSSNFADQNDLFDDLGSPLLDNAFGGYNNCIFAYGQTGSGKSYSMMGYGKEYGVIPRICRSMFERITAIQADKSL
NCTVEVSYLEIYNERVRDLLNPSNKGNLKVREHPSTGPYVEDLAKLVVGCFEEIESLMDEGNKARTVAATNMNET
SSRSHAVFTLTLTQKRHDKETSMDTEKVSKISLVDLAGSERANSTGATGARLKEGAEINRSLSTLGRVIAALADV
SAGKTTAGKKKNASMVPYRDSILTWLLKDSLGGNSMTSMIAAISPADINFDETLGTLRYADSAKRIKNHAVVNED
PNARMIRELKEELAQLRSKLGGGVAPGGAAGAIGGGVPQEYYPPDTPLEKQMVSIQQPDGTVTQVSKAEIVEQLN
QSEKLYKDLNQTWEEKLQNTELIHKEREAALEELGINIEKGFIGMSTPKKMPHLVNLSDDPLLAECLVYNIKPGT
TTVGHMDQGQTVEIRLNGSKILEKHCTFENVDNVVTIIPAEGAAIMVNGLRVDKPTRLKSGFRIILGDFHIFRFN
HPQEARAERVEQSLLRHSVTTSQLGSPAPNKTHDRNLSKAGSDLDGDSSRADSPMPQQRSRESDWFLARREAISA
MVGPDQISNLPDDELDTLLEDVQKVRAERRGLPEEDDSDSISSFPTRDKYMSNGTLDNFSLDTAITMPSTPRQND
DDEVNGVASFNQTRQDMQRQLDRRKEEFQEKLKTVGASSDPESPELRTEKERMEDALRTVKEEFEEQLRKQKESF
ETHIRDMGKPVPQIFENGFAKLDERELEIARSVYSHWSQRNYVRMAEKILQHACLLKEAQIMSHIMDKHVVFQFA
IVDHGHNMESSYDLVLNGISGDEDILLDEAKKPCVGVRVIDFKQCVIHLWSIEKLQRRVQAMRQLHQYIDRPDYI
QHFKLDNPFSEPCSPQYSLIGDADIPLTAVFETRVQDFSVEITSPYTQSVVGIIRLSLEPSSAQAPSSTLKFNVV
MRDMVGFAEWEGTDVHAQLFVPGISEEGGATTTQMIKGFEDGPVRFESVHSMSLPLSSPRTAALKVCVYAAVTSV
HLDKLLSWDDMRDSVEPSPQKRTAARIAESEFYSEERHDVFARIQILEMSESGEYLPVEVVQSSSIDAGTSQLHQ
GLQRRISVNITYSSTETLPWDDINNIRVGSVHLLDPWGKIPDQDFQTPDVPLKFVQEPTVKENADGTSHVTIVGQ
WDSSLHGSLLLDRVTAEKYRVQVTVRWDLVSSRLQNPVVFEAEQTIQIQGRTHVRQQSMFKQFWNSIRVVHSTTC
MYSLVIRPISAKRAADLWRMNTQNDYVKGEELLNTWAPRKVSLVRDYIANRKRRQRLAELHAARGALSAGCLIPS
LARGGRSTPMRGADLNERKSKILRKYLDLWSLKQDPTEAILIRSNTEPPSDGAAHIKNSDASGLYDKLSLKPRFT
ATIQTLPKAPDALKTGYVLTPDDTNNVWVRRFLELRRPYLHIYSVPEGDEINAINLRNARVDHAPDFARLLDGSG
AGSDRSLSAKGRPNVFAVYGTQNTFLFATRTEAQKVEWILKIDESYFNSNSPRPPANGDH*
Coding >Pro_DTO377G3_2|g9503.t1
ATGGCTCCAGGCGGCGGTGGAAATATTAAGGTGGTGGTGCGGGTGCGGCCGTTCAACAGCCGAGAGATCGAGCGA
GGTGCAAAATGTATCGTGTCGATGAAAGGCAACCAGACCGTGCTCACTCCTCCACCCGGCGCAGAGGACAAATCA
CGGAAGGGTGGGAAAGGTGTTAGTGAAGGGAACAAGGTCTTTGCCTTTGACCGATCATATTGGTCCTTTGATAAG
AAATCATCAAACTTCGCCGACCAGAATGACCTCTTCGACGATCTGGGTTCTCCGCTTCTGGACAATGCTTTTGGG
GGTTACAACAATTGTATCTTCGCGTATGGCCAGACTGGTTCGGGAAAATCGTACTCCATGATGGGTTACGGCAAA
GAATATGGTGTGATTCCACGGATTTGCCGATCGATGTTCGAGCGCATTACTGCTATCCAGGCGGACAAGTCTTTG
AATTGCACTGTCGAAGTGTCATATCTCGAAATTTACAACGAGCGAGTACGCGACTTGCTCAACCCGTCGAACAAA
GGCAACCTGAAAGTCCGTGAGCATCCGTCAACGGGTCCTTATGTTGAGGATCTGGCCAAACTCGTCGTCGGATGT
TTCGAAGAAATCGAGAGCCTGATGGACGAGGGTAACAAAGCCCGAACGGTTGCCGCGACCAACATGAACGAAACC
TCAAGTCGATCACATGCGGTTTTTACCTTGACTCTGACGCAGAAGAGACACGACAAAGAGACTTCAATGGATACC
GAGAAGGTGTCGAAAATCAGTTTGGTTGATTTGGCTGGTTCAGAAAGAGCTAACTCGACTGGAGCCACCGGCGCG
CGATTAAAGGAGGGTGCGGAAATCAATCGCTCATTGTCAACACTTGGTCGTGTCATTGCTGCACTCGCTGATGTC
TCTGCCGGCAAGACTACTGCCGGCAAGAAGAAGAATGCATCCATGGTACCATATCGTGATTCAATTCTCACATGG
TTGCTGAAGGATTCTCTGGGCGGAAATTCCATGACTTCCATGATTGCGGCAATTTCTCCTGCAGATATCAACTTT
GACGAAACTCTTGGTACTCTGCGATACGCTGACTCGGCGAAACGAATCAAGAACCATGCTGTTGTGAACGAAGAT
CCTAATGCACGCATGATTCGCGAACTAAAGGAGGAATTAGCACAGCTCCGATCAAAACTTGGAGGGGGAGTAGCA
CCGGGAGGAGCAGCTGGCGCAATAGGAGGTGGTGTCCCGCAGGAGTACTACCCCCCAGATACCCCGTTAGAGAAA
CAGATGGTGTCTATCCAACAGCCGGATGGAACTGTCACTCAAGTCAGTAAGGCAGAGATTGTAGAACAACTCAAT
CAGAGTGAGAAGCTCTACAAAGATCTCAACCAGACTTGGGAAGAGAAGCTGCAAAATACGGAGCTTATCCACAAG
GAGCGTGAAGCAGCTTTGGAGGAATTAGGAATCAACATCGAAAAGGGCTTCATTGGAATGAGCACACCAAAGAAA
ATGCCCCATTTGGTCAACCTCAGCGACGATCCCCTACTTGCAGAATGTTTGGTCTACAATATCAAACCTGGGACT
ACCACGGTCGGCCATATGGATCAAGGTCAAACCGTCGAGATTAGATTGAATGGATCCAAGATCCTTGAGAAGCAC
TGCACTTTCGAGAATGTGGACAACGTTGTGACCATTATACCCGCCGAAGGCGCTGCTATCATGGTGAACGGCCTG
CGGGTTGACAAGCCCACACGACTGAAGAGTGGTTTCCGAATCATCCTTGGCGATTTTCATATTTTCCGTTTCAAC
CATCCTCAAGAGGCTAGAGCCGAACGGGTCGAGCAGAGCTTACTCCGCCATTCAGTCACAACAAGCCAGCTCGGG
TCGCCGGCCCCAAACAAAACCCATGATCGAAATCTGAGCAAGGCAGGATCTGACTTGGATGGCGATTCATCTAGG
GCGGATTCACCCATGCCCCAACAGCGTAGTCGTGAGTCAGACTGGTTCTTAGCACGCAGAGAAGCTATCAGTGCT
ATGGTTGGACCTGATCAGATCTCCAATTTGCCTGATGATGAACTGGATACACTGTTGGAAGATGTGCAGAAGGTT
CGAGCTGAACGACGTGGACTGCCGGAAGAAGACGATTCCGACTCCATCAGCTCCTTCCCAACTAGGGACAAGTAT
ATGTCCAACGGGACCCTCGACAACTTTTCCTTAGATACTGCTATAACTATGCCAAGCACGCCCCGACAGAATGAC
GACGATGAAGTCAATGGCGTTGCATCATTTAACCAAACTCGACAAGATATGCAGCGGCAGTTGGATCGTCGCAAG
GAAGAGTTCCAAGAAAAACTCAAGACCGTGGGAGCTTCGTCTGATCCAGAATCGCCGGAGCTACGCACCGAGAAG
GAGCGAATGGAGGACGCTCTGCGGACGGTTAAAGAGGAATTCGAAGAGCAACTGCGCAAACAAAAGGAGTCTTTT
GAAACCCACATCCGAGATATGGGTAAGCCAGTACCTCAAATCTTCGAAAATGGCTTCGCCAAGTTAGATGAACGT
GAACTTGAAATCGCGCGTTCAGTATACAGCCACTGGTCCCAGCGAAATTATGTCCGAATGGCTGAGAAGATTTTA
CAACATGCCTGCCTTCTGAAGGAGGCACAGATCATGAGTCATATCATGGACAAGCATGTGGTCTTCCAGTTCGCC
ATTGTCGACCATGGCCACAACATGGAATCGTCCTATGATCTCGTGCTCAACGGAATCTCCGGCGATGAAGACATC
CTGCTTGATGAGGCCAAGAAACCCTGTGTGGGTGTTCGAGTCATCGACTTCAAGCAGTGCGTAATTCACTTGTGG
TCAATTGAAAAACTCCAACGCCGCGTCCAAGCCATGCGGCAATTGCACCAATACATCGACCGCCCTGACTACATT
CAACACTTCAAACTCGACAATCCATTCTCTGAACCTTGCTCACCCCAGTATTCTCTTATCGGTGATGCCGACATC
CCCTTAACCGCTGTTTTCGAAACTCGCGTGCAAGACTTCTCCGTTGAGATAACCTCACCATATACTCAGAGTGTC
GTCGGAATCATTCGTCTCTCTCTCGAACCATCCTCCGCGCAGGCGCCCTCTTCAACCCTGAAATTTAACGTTGTC
ATGCGGGACATGGTCGGGTTCGCAGAGTGGGAAGGGACTGATGTACATGCGCAGTTATTTGTTCCGGGTATCTCA
GAGGAAGGAGGCGCAACTACAACTCAAATGATCAAAGGATTTGAGGACGGTCCCGTTCGATTTGAAAGTGTGCAC
AGTATGAGCTTGCCGCTGTCAAGTCCACGGACAGCCGCATTGAAGGTCTGCGTTTATGCAGCTGTGACATCGGTT
CATCTCGACAAGCTTCTTAGTTGGGATGATATGCGTGACTCAGTGGAGCCTTCACCGCAAAAGCGGACTGCTGCT
CGGATCGCGGAATCAGAATTTTACTCAGAAGAACGTCATGACGTCTTTGCGAGAATTCAGATTCTCGAAATGTCA
GAATCTGGCGAGTACCTCCCCGTGGAGGTTGTCCAAAGCAGCAGTATTGATGCCGGGACATCCCAGCTTCATCAA
GGATTGCAGCGCCGCATCTCAGTCAACATCACGTACAGTTCAACAGAAACTCTTCCATGGGATGATATCAACAAC
ATCCGCGTTGGTTCTGTCCACCTCCTGGATCCTTGGGGCAAGATCCCAGATCAGGATTTCCAGACTCCAGACGTC
CCCTTGAAGTTTGTCCAAGAACCAACGGTCAAAGAAAATGCCGACGGAACCTCTCATGTCACAATTGTCGGCCAG
TGGGACTCGAGTTTACATGGCTCTCTGTTGCTTGACCGAGTGACAGCAGAAAAGTACAGGGTCCAAGTAACTGTC
CGTTGGGATCTTGTATCCAGTCGTTTACAGAACCCAGTTGTGTTCGAGGCAGAGCAAACCATTCAAATCCAAGGC
CGTACCCATGTCCGCCAACAGTCGATGTTCAAGCAATTCTGGAACTCGATTCGTGTTGTGCACTCGACGACTTGC
ATGTACTCCTTGGTTATTCGGCCTATTTCAGCTAAGCGTGCTGCTGATCTGTGGCGTATGAACACACAAAATGAC
TATGTGAAAGGCGAGGAGCTCTTGAACACCTGGGCGCCTAGAAAAGTTTCTCTGGTACGAGACTACATTGCCAAC
CGCAAACGCCGGCAGCGGCTGGCAGAGCTTCACGCAGCCCGAGGTGCTCTGAGCGCGGGCTGTCTCATTCCATCG
CTGGCTCGTGGTGGGAGGTCAACTCCGATGCGGGGTGCAGATCTCAATGAGCGAAAATCCAAAATTCTACGGAAG
TATCTTGATCTGTGGTCGCTCAAGCAGGACCCAACAGAGGCAATCCTCATCCGGAGTAATACCGAACCCCCTTCG
GACGGAGCGGCACACATTAAAAATTCGGATGCCAGCGGCCTTTATGATAAACTTTCTCTCAAACCTCGCTTCACA
GCCACCATCCAAACCCTTCCCAAAGCCCCCGACGCCTTAAAAACGGGGTACGTGCTTACGCCCGATGATACCAAC
AACGTTTGGGTGCGTCGTTTCTTGGAGCTCCGCCGGCCGTACCTCCACATCTACTCGGTCCCAGAGGGAGACGAG
ATTAACGCCATCAACCTCCGCAATGCGCGTGTCGACCATGCGCCCGACTTCGCAAGACTACTCGACGGTTCAGGA
GCTGGATCCGACCGTTCGCTGTCTGCCAAGGGACGACCGAATGTGTTCGCAGTCTATGGAACCCAGAACACGTTC
CTCTTCGCCACTAGAACCGAGGCACAAAAGGTAGAATGGATCTTGAAGATAGACGAGAGCTACTTCAACAGCAAC
AGCCCCAGACCCCCCGCCAATGGCGACCATTAA
Transcript >Pro_DTO377G3_2|g9503.t1
ATGGCTCCAGGCGGCGGTGGAAATATTAAGGTGGTGGTGCGGGTGCGGCCGTTCAACAGCCGAGAGATCGAGCGA
GGTGCAAAATGTATCGTGTCGATGAAAGGCAACCAGACCGTGCTCACTCCTCCACCCGGCGCAGAGGACAAATCA
CGGAAGGGTGGGAAAGGTGTTAGTGAAGGGAACAAGGTCTTTGCCTTTGACCGATCATATTGGTCCTTTGATAAG
AAATCATCAAACTTCGCCGACCAGAATGACCTCTTCGACGATCTGGGTTCTCCGCTTCTGGACAATGCTTTTGGG
GGTTACAACAATTGTATCTTCGCGTATGGCCAGACTGGTTCGGGAAAATCGTACTCCATGATGGGTTACGGCAAA
GAATATGGTGTGATTCCACGGATTTGCCGATCGATGTTCGAGCGCATTACTGCTATCCAGGCGGACAAGTCTTTG
AATTGCACTGTCGAAGTGTCATATCTCGAAATTTACAACGAGCGAGTACGCGACTTGCTCAACCCGTCGAACAAA
GGCAACCTGAAAGTCCGTGAGCATCCGTCAACGGGTCCTTATGTTGAGGATCTGGCCAAACTCGTCGTCGGATGT
TTCGAAGAAATCGAGAGCCTGATGGACGAGGGTAACAAAGCCCGAACGGTTGCCGCGACCAACATGAACGAAACC
TCAAGTCGATCACATGCGGTTTTTACCTTGACTCTGACGCAGAAGAGACACGACAAAGAGACTTCAATGGATACC
GAGAAGGTGTCGAAAATCAGTTTGGTTGATTTGGCTGGTTCAGAAAGAGCTAACTCGACTGGAGCCACCGGCGCG
CGATTAAAGGAGGGTGCGGAAATCAATCGCTCATTGTCAACACTTGGTCGTGTCATTGCTGCACTCGCTGATGTC
TCTGCCGGCAAGACTACTGCCGGCAAGAAGAAGAATGCATCCATGGTACCATATCGTGATTCAATTCTCACATGG
TTGCTGAAGGATTCTCTGGGCGGAAATTCCATGACTTCCATGATTGCGGCAATTTCTCCTGCAGATATCAACTTT
GACGAAACTCTTGGTACTCTGCGATACGCTGACTCGGCGAAACGAATCAAGAACCATGCTGTTGTGAACGAAGAT
CCTAATGCACGCATGATTCGCGAACTAAAGGAGGAATTAGCACAGCTCCGATCAAAACTTGGAGGGGGAGTAGCA
CCGGGAGGAGCAGCTGGCGCAATAGGAGGTGGTGTCCCGCAGGAGTACTACCCCCCAGATACCCCGTTAGAGAAA
CAGATGGTGTCTATCCAACAGCCGGATGGAACTGTCACTCAAGTCAGTAAGGCAGAGATTGTAGAACAACTCAAT
CAGAGTGAGAAGCTCTACAAAGATCTCAACCAGACTTGGGAAGAGAAGCTGCAAAATACGGAGCTTATCCACAAG
GAGCGTGAAGCAGCTTTGGAGGAATTAGGAATCAACATCGAAAAGGGCTTCATTGGAATGAGCACACCAAAGAAA
ATGCCCCATTTGGTCAACCTCAGCGACGATCCCCTACTTGCAGAATGTTTGGTCTACAATATCAAACCTGGGACT
ACCACGGTCGGCCATATGGATCAAGGTCAAACCGTCGAGATTAGATTGAATGGATCCAAGATCCTTGAGAAGCAC
TGCACTTTCGAGAATGTGGACAACGTTGTGACCATTATACCCGCCGAAGGCGCTGCTATCATGGTGAACGGCCTG
CGGGTTGACAAGCCCACACGACTGAAGAGTGGTTTCCGAATCATCCTTGGCGATTTTCATATTTTCCGTTTCAAC
CATCCTCAAGAGGCTAGAGCCGAACGGGTCGAGCAGAGCTTACTCCGCCATTCAGTCACAACAAGCCAGCTCGGG
TCGCCGGCCCCAAACAAAACCCATGATCGAAATCTGAGCAAGGCAGGATCTGACTTGGATGGCGATTCATCTAGG
GCGGATTCACCCATGCCCCAACAGCGTAGTCGTGAGTCAGACTGGTTCTTAGCACGCAGAGAAGCTATCAGTGCT
ATGGTTGGACCTGATCAGATCTCCAATTTGCCTGATGATGAACTGGATACACTGTTGGAAGATGTGCAGAAGGTT
CGAGCTGAACGACGTGGACTGCCGGAAGAAGACGATTCCGACTCCATCAGCTCCTTCCCAACTAGGGACAAGTAT
ATGTCCAACGGGACCCTCGACAACTTTTCCTTAGATACTGCTATAACTATGCCAAGCACGCCCCGACAGAATGAC
GACGATGAAGTCAATGGCGTTGCATCATTTAACCAAACTCGACAAGATATGCAGCGGCAGTTGGATCGTCGCAAG
GAAGAGTTCCAAGAAAAACTCAAGACCGTGGGAGCTTCGTCTGATCCAGAATCGCCGGAGCTACGCACCGAGAAG
GAGCGAATGGAGGACGCTCTGCGGACGGTTAAAGAGGAATTCGAAGAGCAACTGCGCAAACAAAAGGAGTCTTTT
GAAACCCACATCCGAGATATGGGTAAGCCAGTACCTCAAATCTTCGAAAATGGCTTCGCCAAGTTAGATGAACGT
GAACTTGAAATCGCGCGTTCAGTATACAGCCACTGGTCCCAGCGAAATTATGTCCGAATGGCTGAGAAGATTTTA
CAACATGCCTGCCTTCTGAAGGAGGCACAGATCATGAGTCATATCATGGACAAGCATGTGGTCTTCCAGTTCGCC
ATTGTCGACCATGGCCACAACATGGAATCGTCCTATGATCTCGTGCTCAACGGAATCTCCGGCGATGAAGACATC
CTGCTTGATGAGGCCAAGAAACCCTGTGTGGGTGTTCGAGTCATCGACTTCAAGCAGTGCGTAATTCACTTGTGG
TCAATTGAAAAACTCCAACGCCGCGTCCAAGCCATGCGGCAATTGCACCAATACATCGACCGCCCTGACTACATT
CAACACTTCAAACTCGACAATCCATTCTCTGAACCTTGCTCACCCCAGTATTCTCTTATCGGTGATGCCGACATC
CCCTTAACCGCTGTTTTCGAAACTCGCGTGCAAGACTTCTCCGTTGAGATAACCTCACCATATACTCAGAGTGTC
GTCGGAATCATTCGTCTCTCTCTCGAACCATCCTCCGCGCAGGCGCCCTCTTCAACCCTGAAATTTAACGTTGTC
ATGCGGGACATGGTCGGGTTCGCAGAGTGGGAAGGGACTGATGTACATGCGCAGTTATTTGTTCCGGGTATCTCA
GAGGAAGGAGGCGCAACTACAACTCAAATGATCAAAGGATTTGAGGACGGTCCCGTTCGATTTGAAAGTGTGCAC
AGTATGAGCTTGCCGCTGTCAAGTCCACGGACAGCCGCATTGAAGGTCTGCGTTTATGCAGCTGTGACATCGGTT
CATCTCGACAAGCTTCTTAGTTGGGATGATATGCGTGACTCAGTGGAGCCTTCACCGCAAAAGCGGACTGCTGCT
CGGATCGCGGAATCAGAATTTTACTCAGAAGAACGTCATGACGTCTTTGCGAGAATTCAGATTCTCGAAATGTCA
GAATCTGGCGAGTACCTCCCCGTGGAGGTTGTCCAAAGCAGCAGTATTGATGCCGGGACATCCCAGCTTCATCAA
GGATTGCAGCGCCGCATCTCAGTCAACATCACGTACAGTTCAACAGAAACTCTTCCATGGGATGATATCAACAAC
ATCCGCGTTGGTTCTGTCCACCTCCTGGATCCTTGGGGCAAGATCCCAGATCAGGATTTCCAGACTCCAGACGTC
CCCTTGAAGTTTGTCCAAGAACCAACGGTCAAAGAAAATGCCGACGGAACCTCTCATGTCACAATTGTCGGCCAG
TGGGACTCGAGTTTACATGGCTCTCTGTTGCTTGACCGAGTGACAGCAGAAAAGTACAGGGTCCAAGTAACTGTC
CGTTGGGATCTTGTATCCAGTCGTTTACAGAACCCAGTTGTGTTCGAGGCAGAGCAAACCATTCAAATCCAAGGC
CGTACCCATGTCCGCCAACAGTCGATGTTCAAGCAATTCTGGAACTCGATTCGTGTTGTGCACTCGACGACTTGC
ATGTACTCCTTGGTTATTCGGCCTATTTCAGCTAAGCGTGCTGCTGATCTGTGGCGTATGAACACACAAAATGAC
TATGTGAAAGGCGAGGAGCTCTTGAACACCTGGGCGCCTAGAAAAGTTTCTCTGGTACGAGACTACATTGCCAAC
CGCAAACGCCGGCAGCGGCTGGCAGAGCTTCACGCAGCCCGAGGTGCTCTGAGCGCGGGCTGTCTCATTCCATCG
CTGGCTCGTGGTGGGAGGTCAACTCCGATGCGGGGTGCAGATCTCAATGAGCGAAAATCCAAAATTCTACGGAAG
TATCTTGATCTGTGGTCGCTCAAGCAGGACCCAACAGAGGCAATCCTCATCCGGAGTAATACCGAACCCCCTTCG
GACGGAGCGGCACACATTAAAAATTCGGATGCCAGCGGCCTTTATGATAAACTTTCTCTCAAACCTCGCTTCACA
GCCACCATCCAAACCCTTCCCAAAGCCCCCGACGCCTTAAAAACGGGGTACGTGCTTACGCCCGATGATACCAAC
AACGTTTGGGTGCGTCGTTTCTTGGAGCTCCGCCGGCCGTACCTCCACATCTACTCGGTCCCAGAGGGAGACGAG
ATTAACGCCATCAACCTCCGCAATGCGCGTGTCGACCATGCGCCCGACTTCGCAAGACTACTCGACGGTTCAGGA
GCTGGATCCGACCGTTCGCTGTCTGCCAAGGGACGACCGAATGTGTTCGCAGTCTATGGAACCCAGAACACGTTC
CTCTTCGCCACTAGAACCGAGGCACAAAAGGTAGAATGGATCTTGAAGATAGACGAGAGCTACTTCAACAGCAAC
AGCCCCAGACCCCCCGCCAATGGCGACCATTAA
Gene >Pro_DTO377G3_2|g9503.t1
ATGGCTCCAGGCGGCGGTGGAAATATTAAGGTGGTGGTGCGGGTGCGGCCGTTCAACAGCCGAGGTGAGTAAATA
TCGAGGGATGGATTCGTTTTTGAGCCTCAAGCTAACCAGTCTGTCATTGTGCAGAGATCGAGCGAGGTGCAAAAT
GTATCGTGTCGATGAAAGGCAACCAGACCGTGCTCACTCCTCCACCCGGCGCAGAGGACAAATCACGGAAGGGTG
GGAAAGGTGTTAGTGAAGGGAACAAGGTCTTTGCCTTTGACCGATCATATTGGTCCTTTGATAAGAAATCATCAA
ACTTCGCCGACCAGAATGACCTCTTCGACGATCTGGGTTCTCCGCTTCTGGACAATGCTTTTGGGGGTTACAACA
ATTGTATCTTCGCGTATGGCCAGACTGGTTCGGGAAAATCGTACTCCATGATGGGTTACGGCAAAGAATATGGTG
TGATTCCACGGATTTGCCGATCGATGTTCGAGCGCATTACTGCTATCCAGGCGGACAAGTCTTTGAATTGCACTG
TCGAAGTGTCATATCTCGAAATTTACAACGAGCGAGTACGCGACTTGCTCAACCCGTCGAACAAAGGCAACCTGA
AAGTCCGTGAGCATCCGTCAACGGGTCCTTATGTTGAGGATCTGGCCAAACTCGTCGTCGGATGTTTCGAAGAAA
TCGAGAGCCTGATGGACGAGGGTAACAAAGCCCGAACGGTTGCCGCGACCAACATGAACGAAACCTCAAGTCGAT
CACATGCGGTTTTTACCTTGACTCTGACGCAGAAGAGACACGACAAAGAGACTTCAATGGATACCGAGAAGGTGT
CGAAAATCAGTTTGGTTGATTTGGCTGGTTCAGAAAGAGCTAACTCGACTGGAGCCACCGGCGCGCGATTAAAGG
AGGGTGCGGAAATCAATCGCTCATTGTCAACACTTGGTCGTGTCATTGCTGCACTCGCTGATGTCTCTGCCGGCA
AGACTACTGCCGGCAAGAAGAAGAATGCATCCATGGTACCATATCGTGATTCAATTCTCACATGGTTGCTGAAGG
ATTCTCTGGGCGGAAATTCCATGACTTCCATGATTGCGGCAATTTCTCCTGCAGATATCAACTTTGACGAAACTC
TTGGTACTCTGCGATACGCTGACTCGGCGAAACGAATCAAGAACCATGCTGTTGTGAACGAAGATCCTAATGCAC
GCATGATTCGCGAACTAAAGGAGGAATTAGCACAGCTCCGATCAAAACTTGGAGGGGGAGTAGCACCGGGAGGAG
CAGCTGGCGCAATAGGAGGTGGTGTCCCGCAGGAGTACTACCCCCCAGATACCCCGTTAGAGAAACAGATGGTGT
CTATCCAACAGCCGGATGGAACTGTCACTCAAGTCAGTAAGGCAGAGATTGTAGAACAACTCAATCAGAGTGAGA
AGCTCTACAAAGATCTCAACCAGACTTGGGAAGAGAAGCTGCAAAATACGGAGCTTATCCACAAGGAGCGTGAAG
CAGCTTTGGAGGAATTAGGAATCAACATCGAAAAGGGCTTCATTGGAATGAGCACACCAAAGAAAATGCCCCATT
TGGTCAACCTCAGCGACGATCCCCTACTTGCAGAATGTTTGGTCTACAATATCAAACCTGGGACTACCACGGTCG
GCCATATGGATCAAGGTCAAACCGTCGAGATTAGATTGAATGGATCCAAGATCCTTGAGAAGCACTGCACTTTCG
AGAATGTGGACAACGTTGTGACCATTATACCCGCCGAAGGCGCTGCTATCATGGTGAACGGCCTGCGGGTTGACA
AGCCCACACGACTGAAGAGTGGTTTCCGAATCATCCTTGGCGATTTTCATATTTTCCGTTTCAACCATCCTCAAG
AGGCTAGAGCCGAACGGGTCGAGCAGAGCTTACTCCGCCATTCAGTCACAACAAGCCAGCTCGGGTCGCCGGCCC
CAAACAAAACCCATGATCGAAATCTGAGCAAGGCAGGATCTGACTTGGATGGCGATTCATCTAGGGCGGATTCAC
CCATGCCCCAACAGCGTAGTCGTGAGTCAGACTGGTTCTTAGCACGCAGAGAAGCTATCAGTGCTATGGTTGGAC
CTGATCAGATCTCCAATTTGCCTGATGATGAACTGGATACACTGTTGGAAGATGTGCAGAAGGTTCGAGCTGAAC
GACGTGGACTGCCGGAAGAAGACGATTCCGACTCCATCAGCTCCTTCCCAACTAGGGACAAGTATATGTCCAACG
GGACCCTCGACAACTTTTCCTTAGATACTGCTATAACTATGCCAAGCACGCCCCGACAGAATGACGACGATGAAG
TCAATGGCGTTGCATCATTTAACCAAACTCGACAAGATATGCAGCGGCAGTTGGATCGTCGCAAGGAAGAGTTCC
AAGAAAAACTCAAGACCGTGGGAGCTTCGTCTGATCCAGAATCGCCGGAGCTACGCACCGAGAAGGAGCGAATGG
AGGACGCTCTGCGGACGGTTAAAGAGGAATTCGAAGAGCAACTGCGCAAACAAAAGGAGTCTTTTGAAACCCACA
TCCGAGATATGGGTAAGCCAGTACCTCAAATCTTCGAAAATGGCTTCGCCAAGTTAGATGAACGTGAACTTGAAA
TCGCGCGTTCAGTATACAGCCACTGGTCCCAGCGAAATTATGTCCGAATGGCTGAGAAGATTTTACAACATGCCT
GCCTTCTGAAGGAGGCACAGATCATGAGTCATATCATGGACAAGCATGTGGTCTTCCAGTTCGCCATTGTCGACC
ATGGCCACAACATGGAATCGTCCTATGATCTCGTGCTCAACGGAATCTCCGGCGATGAAGACATCCTGCTTGATG
AGGCCAAGAAACCCTGTGTGGGTGTTCGAGTCATCGACTTCAAGCAGTGCGTAATTCACTTGTGGTCAATTGAAA
AACTCCAACGCCGCGTCCAAGCCATGCGGCAATTGCACCAATACATCGACCGCCCTGACTACATTCAACACTTCA
AACTCGACAATCCATTCTCTGAACCTTGCTCACCCCAGTATTCTCTTATCGGTGATGCCGACATCCCCTTAACCG
CTGTTTTCGAAACTCGCGTGCAAGACTTCTCCGTTGAGATAACCTCACCATATACTCAGAGTGTCGTCGGAATCA
TTCGTCTCTCTCTCGAACCATCCTCCGCGCAGGCGCCCTCTTCAACCCTGAAATTTAACGTTGTCATGCGGGACA
TGGTCGGGTTCGCAGAGTGGGAAGGGACTGATGTACATGCGCAGTTATTTGTTCCGGGTATCTCAGAGGAAGGAG
GCGCAACTACAACTCAAATGATCAAAGGATTTGAGGACGGTCCCGTTCGATTTGAAAGTGTGCACAGTATGAGCT
TGCCGCTGTCAAGTCCACGGACAGCCGCATTGAAGGTCTGCGTTTATGCAGCTGTGACATCGGTTCATCTCGACA
AGCTTCTTAGTTGGGATGATATGCGTGACTCAGTGGAGCCTTCACCGCAAAAGCGGACTGCTGCTCGGATCGCGG
AATCAGAATTTTACTCAGAAGAACGTCATGACGTCTTTGCGAGAATTCAGATTCTCGAAATGTCAGAATCTGGCG
AGTACCTCCCCGTGGAGGTTGTCCAAAGCAGCAGTATTGATGCCGGGACATCCCAGCTTCATCAAGGATTGCAGC
GCCGCATCTCAGTCAACATCACGTACAGTTCAACAGAAACTCTTCCATGGGATGATATCAACAACATCCGCGTTG
GTTCTGTCCACCTCCTGGATCCTTGGGGCAAGATCCCAGATCAGGATTTCCAGACTCCAGACGTCCCCTTGAAGT
TTGTCCAAGAACCAACGGTCAAAGAAAATGCCGACGGAACCTCTCATGTCACAATTGTCGGCCAGTGGGACTCGA
GTTTACATGGCTCTCTGTTGCTTGACCGAGTGACAGCAGAAAAGTACAGGGTCCAAGTAACTGTCCGTTGGGATC
TTGTATCCAGTCGTTTACAGAACCCAGTTGTGTTCGAGGCAGAGCAAACCATTCAAATCCAAGGCCGTACCCATG
TCCGCCAACAGTCGATGTTCAAGCAATTCTGGAACTCGATTCGTGTTGTGCACTCGACGACTTGCATGTACTCCT
TGGTTATTCGGCCTATTTCAGCTAAGCGTGCTGCTGATCTGTGGCGTATGAACACACAAAATGACTATGTGAAAG
GCGAGGAGCTCTTGAACACCTGGGCGCCTAGAAAAGTTTCTCTGGTACGAGACTACATTGCCAACCGCAAACGCC
GGCAGCGGCTGGCAGAGCTTCACGCAGCCCGAGGTGCTCTGAGCGCGGGCTGTCTCATTCCATCGCTGGCTCGTG
GTGGGAGGTCAACTCCGATGCGGGGTGCAGATCTCAATGAGCGAAAATCCAAAATTCTACGGAAGTATCTTGATC
TGTGGTCGCTCAAGCAGGACCCAACAGAGGCAATCCTCATCCGGAGTAATACCGAACCCCCTTCGGACGGAGCGG
CACACATTAAAAATTCGGATGCCAGCGGCCTTTATGATAAACTTTCTCTCAAACCTCGCTTCACAGCCACCATCC
AAACCCTTCCCAAAGCCCCCGACGCCTTAAAAACGGGGTACGTGCTTACGCCCGATGATACCAACAACGTTTGGG
TGCGTCGTTTCTTGGAGCTCCGCCGGCCGTACCTCCACATCTACTCGGTCCCAGAGGGAGACGAGATTAACGCCA
TCAACCTCCGCAATGCGCGTGTCGACCATGCGCCCGACTTCGCAAGACTACTCGACGGTTCAGGAGCTGGATCCG
ACCGTTCGCTGTCTGCCAAGGGACGACCGAATGTGTTCGCAGTCTATGGAACCCAGAACACGTTCCTCTTCGCCA
CTAGAACCGAGGCACAAAAGGTAGAATGGATCTTGAAGATAGACGAGAGCTACTTCAACAGCAACAGCCCCAGAC
CCCCCGCCAATGGCGACCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail