Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g950.t1
Gene name
Locationscaffold_01:2514111..2520266
Strand-
Gene length (bp)6155
Transcript length (bp)6075
Coding sequence length (bp)6075
Protein length (aa) 2025

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.1E-08 853 933
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.8E-08 916 1004
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.0E-13 1021 1110
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.2E-10 1155 1246
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.4E-07 1220 1319
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.7E-12 1517 1599
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.6E-11 1576 1662
PF13637 Ank_4 Ankyrin repeats (many copies) 8.2E-07 850 899
PF13637 Ank_4 Ankyrin repeats (many copies) 2.2E-08 1015 1059
PF13637 Ank_4 Ankyrin repeats (many copies) 1.6E-07 1152 1203
PF13606 Ank_3 Ankyrin repeat 2.0E-03 1572 1600
PF00023 Ank Ankyrin repeat 2.7E-02 1117 1144
PF00023 Ank Ankyrin repeat 2.5E-02 1572 1600
PF13401 AAA_22 AAA domain 6.1E-07 404 546
PF00931 NB-ARC NB-ARC domain 1.1E-05 405 521

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0043531 ADP binding Yes
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g950.t1
MSTSLPNERYTVGWVCALPIELSAAKAMLDEEHEGPQTPPKQADDNIYLLGAVGKFNVVITCLPKNEIGSSSAAA
VAKDMLFTFPGIRFGLMVGIGAGIPDYELDEVQDVRLGDVVVSSSKENGGVVVYDFGRRLGDGSIQARYPLNQPP
RSLRTALTRLETEHMLNESQVASFIEKALTKYPKLRKKGGWVRPNQDSDRLFHAEYPHVGGRTCAECDKDYEIDR
QEWERHDTSPVIHYGTIATGNAVVKHAPTRTEIGKTHQAICLEMEAAGLMNAFPCLVIRGISDYADSHKNDTWHN
YAAVAASACAKELLQFVTPKEVEAEDTAQKILNSVSEDVSSIKESVSVLNTAVLEEHQMAILDWLSPHNFNDVQN
DRLAQRIDGTCLWFLETAEMKNWLQSAGQTLFCPGIPGAGKTVMAATIIEHLQSLTKQDPKSVVAYIYCSYQPKS
EQAVQNMLQVLLRQVTAKQRSIPDNIKRLHKEHATAGSRPSIKQLLVVLCQCLRQYNRVFIVLDAVDEYYVSDYE
SHQTLLSELSDIQRDIPINLLMTSRFNNTNVSSKFPGSIQKEIRAHEADILLYLNRKLPIFVVSVAGKVYLEEHI
QSMVLQAADGMFLLAQLHTEYLMKMPTIRHLKRSLEALPRGQDGLTPTYVRAMSDIDRQANEIRDLARKALSWLA
HSKQALSSVELQHALVTESGQSDLDEELLLDIDILHNLCAGLIVWDRATDVVRLIHYTTHEFLQTEGILKDPESQ
VALNCLTYMSFEPFSFGRCSNPESYMDRHERYPLYMYCTKHWGDHARNSNSDDAKNVALQFLASIGCFSAACQSM
KGPPIKRGKPLDSSNILKYSTCRITAAHVCAYFGLTEWLQILLQNGAEVNAKDSKGDTPLTYAARAGHESTVKLI
GPEMSHGVISKDDALEEAAGEGHEADVRYLLSGSAGTEVGQEQKQRALKEAAGKGHVSIMKLLLDQGTNPEYNHI
RGGWFREDSPLELAISSGNLEAVRLLLPKDGTISEYANKNMELVFRAVSDANYEMVQLLLNHGADPDLPNTSGRT
PFIKAVFKGEKSTARLLLSKDIDVNAQDQTGGNPLIYSVRSGDEELVNALLMKGADPNLRAITWDLETPLDRAVS
KGYLKIVQALILKGADPNQPSGSLEDPPLCSAAGNDHEEVVRYLLERGADVNLSNKVNETPLFFAIKARRIQISR
LLLSEGAKLDSQNIVGNTALFYAVQCPSNSLAADLITRGSDPNQRNELEETPLFFAARAGSLSSVHLLLNGGAHA
DPRNKLRETPLLQAATFLCADKESCMEYAAIIELLIANGADPNPTPDLGYPHILFDAVGDGDLVSQWSESDPEKF
QQVQESWSKSKRLSKDLFALFCEHISGRNGEGYSKWKNSWSARRSWKDGLVTPLVWSVRAGCTDLSRRLVDLGLD
DMDAPSSEPLLYKAADFKHNKVADLIYKSDLQVYVQNIKPGERGTVGKLAFLSAVEMGNLAIISVLQRHSLSYLT
STTRVGDFALLVSSRCGRINLCHHLIDAGFDLHHRDETGKTSLTLASIEGHNDLVELLLQKGCQTEAEDNTGRTP
LLWAVQLGNTPAVELLLRAGANPNCLEQNSRTPLLFSTLNGDDFMVELLLKYGANPNFANKAGESALSWAVAQNY
EAIANMLLKREARLINENNLNQSPLFWLIRPFLTKRVKSSLTVRRSSYNLKQKAFNKNDIFSVVSTVQVDGKSDF
DGDETVGNDMEAMLRLLISHGQNIDLKDENGRTCLARAAFAPNEDYARIFLRHGANPDTQNDLGETPLFLASLRR
GGSSPSPAQMKRKTDMIDILACNGANPNLATVYGRTPLMTVAASGALEATQILLKITNVNKHLQDRFGRTAFSEA
SERSQPHICGLLDPDEVDHDLPVPETVHQMASPKFCDICRVNICSGDEFYHCELCQGGDYDVCNFCLRNGASCLD
ETHPVSKIIAVPRKAIEPKNSTTEDPSSLMAAHMASLMMASIQSMIGKCSTSSQSGSSESRDASNRLRVRMWRP*
Coding >Pro_DTO377G3_2|g950.t1
ATGTCGACTAGCTTGCCGAATGAAAGATACACAGTCGGATGGGTGTGTGCGCTCCCAATCGAGCTGAGTGCAGCC
AAGGCTATGTTGGACGAGGAGCACGAAGGCCCACAGACACCACCGAAGCAGGCAGATGACAACATTTATTTGCTG
GGAGCCGTGGGAAAATTTAATGTTGTCATCACATGTTTGCCAAAGAACGAGATTGGCTCCAGCTCCGCCGCCGCG
GTTGCCAAGGACATGCTTTTTACCTTTCCTGGCATTCGTTTTGGCTTGATGGTAGGCATTGGAGCAGGAATTCCT
GACTACGAGCTCGATGAGGTCCAAGATGTGCGGCTTGGAGATGTTGTTGTCAGTTCCAGTAAAGAAAATGGTGGA
GTCGTTGTCTATGACTTTGGCAGGAGGCTCGGAGACGGCTCAATCCAGGCCAGGTACCCGTTGAATCAGCCGCCG
AGGTCTCTGAGGACAGCCTTAACCCGGCTGGAGACTGAGCATATGTTGAACGAAAGTCAGGTTGCATCTTTCATT
GAGAAAGCACTCACCAAATACCCGAAGTTGAGAAAAAAAGGTGGTTGGGTCAGGCCGAATCAAGATTCTGATAGG
CTGTTTCACGCCGAATACCCTCACGTTGGTGGAAGAACATGTGCGGAATGCGACAAAGACTATGAGATAGATCGC
CAGGAATGGGAAAGACATGATACCAGCCCGGTGATTCATTATGGAACCATTGCTACAGGCAATGCGGTTGTCAAG
CACGCACCAACACGGACCGAAATTGGAAAAACACATCAGGCCATTTGCTTGGAAATGGAAGCGGCTGGGTTGATG
AACGCCTTTCCCTGCCTTGTTATTCGCGGAATATCCGACTATGCAGATTCCCACAAGAACGACACCTGGCACAAC
TACGCTGCAGTAGCTGCATCGGCTTGTGCCAAAGAGCTGCTGCAATTTGTGACGCCTAAAGAGGTTGAAGCAGAG
GATACTGCGCAAAAAATCTTGAATTCTGTTAGTGAGGACGTATCATCAATCAAAGAAAGTGTTTCTGTCCTCAAT
ACGGCTGTTCTCGAAGAGCATCAAATGGCCATCCTTGACTGGCTATCCCCACACAACTTCAACGATGTGCAGAAT
GATAGACTGGCCCAAAGAATAGACGGAACATGCCTGTGGTTTCTTGAGACCGCTGAAATGAAGAATTGGCTTCAA
AGCGCTGGTCAAACTTTGTTCTGCCCTGGTATCCCGGGCGCTGGGAAGACGGTCATGGCTGCCACCATCATTGAG
CATCTTCAATCTCTGACGAAGCAAGATCCAAAGTCTGTTGTTGCATATATCTACTGCAGCTATCAGCCAAAATCT
GAACAGGCTGTTCAGAATATGCTACAGGTGCTGCTACGGCAGGTCACTGCCAAGCAGAGAAGCATCCCAGACAAC
ATCAAACGCCTCCACAAAGAACATGCCACCGCGGGCTCTCGTCCATCAATCAAACAGCTGTTGGTGGTGCTTTGC
CAATGTCTGAGGCAGTACAACCGTGTGTTCATTGTCCTTGATGCAGTGGACGAATATTATGTCTCGGATTACGAG
AGCCACCAAACACTGCTTTCTGAGCTATCTGATATCCAAAGGGACATTCCAATCAATTTGCTGATGACTTCACGG
TTCAACAACACGAATGTTTCGTCAAAATTTCCTGGCTCAATACAGAAGGAAATTCGGGCGCACGAAGCCGATATC
CTCCTATACTTGAATCGGAAGTTGCCAATTTTTGTGGTCAGTGTCGCCGGAAAAGTATATCTCGAAGAACATATC
CAATCCATGGTGCTTCAAGCTGCAGACGGAATGTTTCTGCTTGCTCAGCTTCATACAGAGTACCTGATGAAGATG
CCAACGATCCGCCATCTCAAGCGTTCCCTCGAGGCTCTACCCAGAGGTCAGGACGGTTTAACCCCGACTTATGTA
CGAGCGATGTCGGACATTGATCGACAGGCAAATGAAATTCGCGATTTGGCAAGGAAGGCTCTGTCTTGGCTCGCC
CACAGCAAACAAGCACTCAGCTCCGTCGAATTGCAGCATGCATTAGTGACTGAAAGCGGGCAGTCTGACCTAGAT
GAAGAGCTTCTGCTGGATATTGATATTCTTCATAATCTGTGTGCGGGACTAATAGTCTGGGATCGAGCAACCGAT
GTTGTGCGCCTCATTCATTACACCACACATGAGTTTCTTCAGACAGAAGGTATTTTGAAGGACCCCGAGAGTCAA
GTAGCGCTAAACTGTCTCACTTACATGTCATTTGAGCCCTTTTCCTTCGGCCGCTGCAGTAACCCAGAATCATAC
ATGGATCGGCATGAGCGATATCCCTTGTACATGTATTGCACGAAACACTGGGGAGACCATGCGCGAAATTCAAAT
AGCGATGATGCAAAGAATGTTGCGCTTCAGTTTTTAGCCAGCATCGGATGCTTTTCTGCTGCTTGTCAAAGCATG
AAGGGGCCTCCAATCAAGCGGGGCAAACCCCTGGATTCATCAAACATCTTGAAGTACAGTACATGCAGGATAACG
GCAGCCCATGTTTGCGCATACTTTGGTCTCACTGAATGGCTTCAAATCCTACTTCAAAACGGGGCTGAAGTCAAT
GCGAAAGACTCGAAGGGGGACACCCCTTTGACCTACGCTGCACGGGCAGGTCACGAGAGCACCGTCAAGCTCATC
GGGCCTGAAATGAGCCATGGTGTGATTTCAAAAGATGATGCACTGGAGGAAGCTGCTGGTGAAGGGCATGAAGCC
GATGTTAGGTATTTGCTATCCGGTTCCGCCGGTACCGAAGTTGGACAAGAACAGAAGCAGCGGGCACTTAAGGAA
GCTGCTGGAAAGGGTCATGTCTCAATCATGAAGCTCCTCCTTGACCAGGGGACCAATCCTGAATACAATCATATC
AGGGGTGGTTGGTTCAGAGAGGATAGTCCGCTAGAGCTGGCTATATCTTCGGGAAACCTAGAAGCAGTTCGCTTA
CTTCTGCCAAAGGATGGCACTATCAGCGAATACGCTAACAAGAACATGGAGCTGGTTTTTAGAGCAGTGTCTGAT
GCGAACTACGAGATGGTTCAACTGTTGCTCAATCATGGAGCTGATCCTGACTTGCCAAATACGAGCGGACGAACG
CCTTTCATCAAAGCAGTTTTCAAGGGTGAAAAAAGCACAGCGAGACTGCTTCTGAGCAAAGACATTGATGTCAAT
GCTCAGGATCAGACTGGTGGCAACCCTTTGATATATTCCGTTCGCAGTGGTGATGAAGAGTTGGTAAATGCGCTG
TTGATGAAAGGCGCTGACCCAAATCTGAGGGCAATCACGTGGGACCTTGAGACTCCATTGGACCGGGCAGTGTCA
AAGGGATATCTGAAAATTGTTCAAGCTCTCATACTCAAAGGGGCAGACCCCAACCAACCAAGCGGCTCCCTGGAG
GATCCCCCTCTGTGCAGTGCCGCAGGGAACGATCATGAAGAGGTTGTGAGATATCTTCTTGAGCGTGGTGCCGAC
GTCAATTTGTCAAACAAAGTAAACGAAACACCGTTGTTCTTTGCCATAAAAGCGAGGCGCATCCAGATATCAAGA
CTTTTGTTGAGCGAAGGTGCTAAGCTCGACAGCCAAAACATTGTTGGAAACACAGCTCTCTTTTATGCCGTCCAA
TGCCCATCCAACTCACTTGCAGCCGATCTAATCACAAGAGGAAGTGATCCGAATCAAAGGAATGAGTTGGAAGAG
ACTCCGCTTTTCTTCGCAGCCAGAGCAGGATCTCTGTCGTCGGTCCACCTTTTACTGAACGGTGGGGCTCACGCG
GACCCGAGGAACAAATTAAGAGAGACGCCATTACTTCAGGCAGCTACATTCCTTTGTGCTGACAAAGAGTCTTGC
ATGGAATATGCCGCCATCATTGAATTGCTTATAGCAAATGGGGCTGATCCCAATCCAACTCCCGATTTAGGATAC
CCTCATATCTTATTTGACGCAGTTGGAGACGGGGACTTGGTGAGTCAATGGTCGGAATCGGACCCAGAAAAGTTC
CAACAAGTCCAAGAATCTTGGTCCAAGTCCAAGAGACTTTCAAAAGATCTCTTTGCTTTGTTTTGTGAGCATATT
TCGGGGAGAAATGGGGAGGGATATTCAAAGTGGAAAAATTCTTGGTCGGCGAGACGTTCTTGGAAAGATGGTCTA
GTGACTCCACTGGTCTGGTCTGTACGTGCGGGCTGCACTGATCTTTCCCGGCGGTTGGTTGATCTAGGGCTTGAT
GATATGGACGCTCCTTCTTCGGAGCCTCTGTTGTACAAGGCAGCTGATTTCAAACACAACAAGGTAGCTGACCTC
ATTTATAAGTCAGACCTCCAGGTATATGTTCAGAATATCAAGCCTGGAGAACGCGGAACCGTTGGAAAGCTAGCG
TTTTTGTCGGCAGTGGAGATGGGAAACCTGGCTATTATCTCAGTTCTTCAACGCCATTCGCTGTCTTACCTCACG
TCAACAACTCGTGTTGGGGATTTTGCTCTGCTTGTGTCTTCAAGATGTGGGCGAATTAACCTGTGTCATCATCTC
ATCGATGCAGGCTTTGACCTCCATCATCGCGATGAAACGGGAAAAACCAGCTTGACTTTGGCGTCCATTGAAGGG
CACAATGACCTTGTGGAACTCCTTCTACAGAAAGGGTGTCAAACGGAAGCTGAAGACAATACAGGCCGGACTCCG
CTCTTGTGGGCTGTGCAACTTGGGAATACACCAGCCGTTGAATTGTTGCTGCGAGCAGGCGCAAATCCCAACTGC
CTTGAACAGAACAGCCGAACACCTTTGTTGTTCTCCACTCTCAACGGTGACGATTTCATGGTTGAGCTACTGCTG
AAGTATGGGGCAAATCCAAATTTCGCGAATAAGGCCGGTGAAAGTGCTCTTTCCTGGGCCGTAGCTCAGAATTAC
GAGGCAATTGCAAACATGCTCCTGAAGCGAGAAGCCAGGCTGATCAACGAGAACAATTTGAACCAATCCCCTCTC
TTTTGGTTGATCAGACCTTTCCTCACTAAGAGGGTCAAAAGCAGTTTAACAGTCAGGCGATCCTCATATAATCTC
AAGCAAAAGGCATTCAACAAGAATGACATCTTTTCTGTGGTGTCCACAGTCCAGGTTGACGGGAAGTCTGACTTT
GACGGTGATGAGACAGTTGGGAATGATATGGAGGCTATGCTGAGACTGCTCATCTCTCATGGTCAAAACATTGAT
CTCAAAGATGAAAATGGAAGGACATGTCTGGCCAGAGCCGCCTTTGCCCCAAATGAGGATTACGCGAGAATATTT
TTACGCCACGGCGCAAACCCGGACACACAAAACGATCTCGGCGAGACACCCCTCTTCCTAGCCTCTCTTAGAAGA
GGTGGCTCGTCACCCTCCCCAGCCCAAATGAAAAGAAAGACAGATATGATCGATATCCTGGCTTGCAACGGTGCC
AATCCGAACCTAGCCACCGTGTATGGTCGTACTCCACTGATGACAGTGGCAGCATCAGGGGCATTAGAGGCCACT
CAGATTTTGTTGAAAATCACCAATGTGAATAAACACCTCCAAGATCGCTTTGGGCGCACTGCCTTCTCGGAAGCT
TCCGAGCGAAGCCAACCACACATCTGTGGTCTATTAGACCCGGATGAGGTGGATCATGACTTGCCGGTACCAGAG
ACTGTCCATCAAATGGCCTCGCCCAAATTCTGTGACATTTGCCGGGTAAACATCTGCAGTGGGGACGAGTTTTAC
CACTGTGAGCTTTGCCAGGGTGGGGACTATGATGTCTGCAATTTCTGTCTCCGAAATGGTGCATCTTGCTTGGAT
GAAACGCATCCGGTTTCGAAAATTATAGCGGTCCCCCGAAAAGCCATCGAACCGAAGAACTCTACCACGGAGGAT
CCATCTTCTTTAATGGCAGCTCACATGGCCTCGCTCATGATGGCCTCAATTCAGTCGATGATTGGAAAGTGCAGC
ACGTCGTCCCAGTCTGGATCCTCAGAGAGCAGGGACGCATCTAATCGACTGAGAGTGAGAATGTGGCGACCCTGA
Transcript >Pro_DTO377G3_2|g950.t1
ATGTCGACTAGCTTGCCGAATGAAAGATACACAGTCGGATGGGTGTGTGCGCTCCCAATCGAGCTGAGTGCAGCC
AAGGCTATGTTGGACGAGGAGCACGAAGGCCCACAGACACCACCGAAGCAGGCAGATGACAACATTTATTTGCTG
GGAGCCGTGGGAAAATTTAATGTTGTCATCACATGTTTGCCAAAGAACGAGATTGGCTCCAGCTCCGCCGCCGCG
GTTGCCAAGGACATGCTTTTTACCTTTCCTGGCATTCGTTTTGGCTTGATGGTAGGCATTGGAGCAGGAATTCCT
GACTACGAGCTCGATGAGGTCCAAGATGTGCGGCTTGGAGATGTTGTTGTCAGTTCCAGTAAAGAAAATGGTGGA
GTCGTTGTCTATGACTTTGGCAGGAGGCTCGGAGACGGCTCAATCCAGGCCAGGTACCCGTTGAATCAGCCGCCG
AGGTCTCTGAGGACAGCCTTAACCCGGCTGGAGACTGAGCATATGTTGAACGAAAGTCAGGTTGCATCTTTCATT
GAGAAAGCACTCACCAAATACCCGAAGTTGAGAAAAAAAGGTGGTTGGGTCAGGCCGAATCAAGATTCTGATAGG
CTGTTTCACGCCGAATACCCTCACGTTGGTGGAAGAACATGTGCGGAATGCGACAAAGACTATGAGATAGATCGC
CAGGAATGGGAAAGACATGATACCAGCCCGGTGATTCATTATGGAACCATTGCTACAGGCAATGCGGTTGTCAAG
CACGCACCAACACGGACCGAAATTGGAAAAACACATCAGGCCATTTGCTTGGAAATGGAAGCGGCTGGGTTGATG
AACGCCTTTCCCTGCCTTGTTATTCGCGGAATATCCGACTATGCAGATTCCCACAAGAACGACACCTGGCACAAC
TACGCTGCAGTAGCTGCATCGGCTTGTGCCAAAGAGCTGCTGCAATTTGTGACGCCTAAAGAGGTTGAAGCAGAG
GATACTGCGCAAAAAATCTTGAATTCTGTTAGTGAGGACGTATCATCAATCAAAGAAAGTGTTTCTGTCCTCAAT
ACGGCTGTTCTCGAAGAGCATCAAATGGCCATCCTTGACTGGCTATCCCCACACAACTTCAACGATGTGCAGAAT
GATAGACTGGCCCAAAGAATAGACGGAACATGCCTGTGGTTTCTTGAGACCGCTGAAATGAAGAATTGGCTTCAA
AGCGCTGGTCAAACTTTGTTCTGCCCTGGTATCCCGGGCGCTGGGAAGACGGTCATGGCTGCCACCATCATTGAG
CATCTTCAATCTCTGACGAAGCAAGATCCAAAGTCTGTTGTTGCATATATCTACTGCAGCTATCAGCCAAAATCT
GAACAGGCTGTTCAGAATATGCTACAGGTGCTGCTACGGCAGGTCACTGCCAAGCAGAGAAGCATCCCAGACAAC
ATCAAACGCCTCCACAAAGAACATGCCACCGCGGGCTCTCGTCCATCAATCAAACAGCTGTTGGTGGTGCTTTGC
CAATGTCTGAGGCAGTACAACCGTGTGTTCATTGTCCTTGATGCAGTGGACGAATATTATGTCTCGGATTACGAG
AGCCACCAAACACTGCTTTCTGAGCTATCTGATATCCAAAGGGACATTCCAATCAATTTGCTGATGACTTCACGG
TTCAACAACACGAATGTTTCGTCAAAATTTCCTGGCTCAATACAGAAGGAAATTCGGGCGCACGAAGCCGATATC
CTCCTATACTTGAATCGGAAGTTGCCAATTTTTGTGGTCAGTGTCGCCGGAAAAGTATATCTCGAAGAACATATC
CAATCCATGGTGCTTCAAGCTGCAGACGGAATGTTTCTGCTTGCTCAGCTTCATACAGAGTACCTGATGAAGATG
CCAACGATCCGCCATCTCAAGCGTTCCCTCGAGGCTCTACCCAGAGGTCAGGACGGTTTAACCCCGACTTATGTA
CGAGCGATGTCGGACATTGATCGACAGGCAAATGAAATTCGCGATTTGGCAAGGAAGGCTCTGTCTTGGCTCGCC
CACAGCAAACAAGCACTCAGCTCCGTCGAATTGCAGCATGCATTAGTGACTGAAAGCGGGCAGTCTGACCTAGAT
GAAGAGCTTCTGCTGGATATTGATATTCTTCATAATCTGTGTGCGGGACTAATAGTCTGGGATCGAGCAACCGAT
GTTGTGCGCCTCATTCATTACACCACACATGAGTTTCTTCAGACAGAAGGTATTTTGAAGGACCCCGAGAGTCAA
GTAGCGCTAAACTGTCTCACTTACATGTCATTTGAGCCCTTTTCCTTCGGCCGCTGCAGTAACCCAGAATCATAC
ATGGATCGGCATGAGCGATATCCCTTGTACATGTATTGCACGAAACACTGGGGAGACCATGCGCGAAATTCAAAT
AGCGATGATGCAAAGAATGTTGCGCTTCAGTTTTTAGCCAGCATCGGATGCTTTTCTGCTGCTTGTCAAAGCATG
AAGGGGCCTCCAATCAAGCGGGGCAAACCCCTGGATTCATCAAACATCTTGAAGTACAGTACATGCAGGATAACG
GCAGCCCATGTTTGCGCATACTTTGGTCTCACTGAATGGCTTCAAATCCTACTTCAAAACGGGGCTGAAGTCAAT
GCGAAAGACTCGAAGGGGGACACCCCTTTGACCTACGCTGCACGGGCAGGTCACGAGAGCACCGTCAAGCTCATC
GGGCCTGAAATGAGCCATGGTGTGATTTCAAAAGATGATGCACTGGAGGAAGCTGCTGGTGAAGGGCATGAAGCC
GATGTTAGGTATTTGCTATCCGGTTCCGCCGGTACCGAAGTTGGACAAGAACAGAAGCAGCGGGCACTTAAGGAA
GCTGCTGGAAAGGGTCATGTCTCAATCATGAAGCTCCTCCTTGACCAGGGGACCAATCCTGAATACAATCATATC
AGGGGTGGTTGGTTCAGAGAGGATAGTCCGCTAGAGCTGGCTATATCTTCGGGAAACCTAGAAGCAGTTCGCTTA
CTTCTGCCAAAGGATGGCACTATCAGCGAATACGCTAACAAGAACATGGAGCTGGTTTTTAGAGCAGTGTCTGAT
GCGAACTACGAGATGGTTCAACTGTTGCTCAATCATGGAGCTGATCCTGACTTGCCAAATACGAGCGGACGAACG
CCTTTCATCAAAGCAGTTTTCAAGGGTGAAAAAAGCACAGCGAGACTGCTTCTGAGCAAAGACATTGATGTCAAT
GCTCAGGATCAGACTGGTGGCAACCCTTTGATATATTCCGTTCGCAGTGGTGATGAAGAGTTGGTAAATGCGCTG
TTGATGAAAGGCGCTGACCCAAATCTGAGGGCAATCACGTGGGACCTTGAGACTCCATTGGACCGGGCAGTGTCA
AAGGGATATCTGAAAATTGTTCAAGCTCTCATACTCAAAGGGGCAGACCCCAACCAACCAAGCGGCTCCCTGGAG
GATCCCCCTCTGTGCAGTGCCGCAGGGAACGATCATGAAGAGGTTGTGAGATATCTTCTTGAGCGTGGTGCCGAC
GTCAATTTGTCAAACAAAGTAAACGAAACACCGTTGTTCTTTGCCATAAAAGCGAGGCGCATCCAGATATCAAGA
CTTTTGTTGAGCGAAGGTGCTAAGCTCGACAGCCAAAACATTGTTGGAAACACAGCTCTCTTTTATGCCGTCCAA
TGCCCATCCAACTCACTTGCAGCCGATCTAATCACAAGAGGAAGTGATCCGAATCAAAGGAATGAGTTGGAAGAG
ACTCCGCTTTTCTTCGCAGCCAGAGCAGGATCTCTGTCGTCGGTCCACCTTTTACTGAACGGTGGGGCTCACGCG
GACCCGAGGAACAAATTAAGAGAGACGCCATTACTTCAGGCAGCTACATTCCTTTGTGCTGACAAAGAGTCTTGC
ATGGAATATGCCGCCATCATTGAATTGCTTATAGCAAATGGGGCTGATCCCAATCCAACTCCCGATTTAGGATAC
CCTCATATCTTATTTGACGCAGTTGGAGACGGGGACTTGGTGAGTCAATGGTCGGAATCGGACCCAGAAAAGTTC
CAACAAGTCCAAGAATCTTGGTCCAAGTCCAAGAGACTTTCAAAAGATCTCTTTGCTTTGTTTTGTGAGCATATT
TCGGGGAGAAATGGGGAGGGATATTCAAAGTGGAAAAATTCTTGGTCGGCGAGACGTTCTTGGAAAGATGGTCTA
GTGACTCCACTGGTCTGGTCTGTACGTGCGGGCTGCACTGATCTTTCCCGGCGGTTGGTTGATCTAGGGCTTGAT
GATATGGACGCTCCTTCTTCGGAGCCTCTGTTGTACAAGGCAGCTGATTTCAAACACAACAAGGTAGCTGACCTC
ATTTATAAGTCAGACCTCCAGGTATATGTTCAGAATATCAAGCCTGGAGAACGCGGAACCGTTGGAAAGCTAGCG
TTTTTGTCGGCAGTGGAGATGGGAAACCTGGCTATTATCTCAGTTCTTCAACGCCATTCGCTGTCTTACCTCACG
TCAACAACTCGTGTTGGGGATTTTGCTCTGCTTGTGTCTTCAAGATGTGGGCGAATTAACCTGTGTCATCATCTC
ATCGATGCAGGCTTTGACCTCCATCATCGCGATGAAACGGGAAAAACCAGCTTGACTTTGGCGTCCATTGAAGGG
CACAATGACCTTGTGGAACTCCTTCTACAGAAAGGGTGTCAAACGGAAGCTGAAGACAATACAGGCCGGACTCCG
CTCTTGTGGGCTGTGCAACTTGGGAATACACCAGCCGTTGAATTGTTGCTGCGAGCAGGCGCAAATCCCAACTGC
CTTGAACAGAACAGCCGAACACCTTTGTTGTTCTCCACTCTCAACGGTGACGATTTCATGGTTGAGCTACTGCTG
AAGTATGGGGCAAATCCAAATTTCGCGAATAAGGCCGGTGAAAGTGCTCTTTCCTGGGCCGTAGCTCAGAATTAC
GAGGCAATTGCAAACATGCTCCTGAAGCGAGAAGCCAGGCTGATCAACGAGAACAATTTGAACCAATCCCCTCTC
TTTTGGTTGATCAGACCTTTCCTCACTAAGAGGGTCAAAAGCAGTTTAACAGTCAGGCGATCCTCATATAATCTC
AAGCAAAAGGCATTCAACAAGAATGACATCTTTTCTGTGGTGTCCACAGTCCAGGTTGACGGGAAGTCTGACTTT
GACGGTGATGAGACAGTTGGGAATGATATGGAGGCTATGCTGAGACTGCTCATCTCTCATGGTCAAAACATTGAT
CTCAAAGATGAAAATGGAAGGACATGTCTGGCCAGAGCCGCCTTTGCCCCAAATGAGGATTACGCGAGAATATTT
TTACGCCACGGCGCAAACCCGGACACACAAAACGATCTCGGCGAGACACCCCTCTTCCTAGCCTCTCTTAGAAGA
GGTGGCTCGTCACCCTCCCCAGCCCAAATGAAAAGAAAGACAGATATGATCGATATCCTGGCTTGCAACGGTGCC
AATCCGAACCTAGCCACCGTGTATGGTCGTACTCCACTGATGACAGTGGCAGCATCAGGGGCATTAGAGGCCACT
CAGATTTTGTTGAAAATCACCAATGTGAATAAACACCTCCAAGATCGCTTTGGGCGCACTGCCTTCTCGGAAGCT
TCCGAGCGAAGCCAACCACACATCTGTGGTCTATTAGACCCGGATGAGGTGGATCATGACTTGCCGGTACCAGAG
ACTGTCCATCAAATGGCCTCGCCCAAATTCTGTGACATTTGCCGGGTAAACATCTGCAGTGGGGACGAGTTTTAC
CACTGTGAGCTTTGCCAGGGTGGGGACTATGATGTCTGCAATTTCTGTCTCCGAAATGGTGCATCTTGCTTGGAT
GAAACGCATCCGGTTTCGAAAATTATAGCGGTCCCCCGAAAAGCCATCGAACCGAAGAACTCTACCACGGAGGAT
CCATCTTCTTTAATGGCAGCTCACATGGCCTCGCTCATGATGGCCTCAATTCAGTCGATGATTGGAAAGTGCAGC
ACGTCGTCCCAGTCTGGATCCTCAGAGAGCAGGGACGCATCTAATCGACTGAGAGTGAGAATGTGGCGACCCTGA
Gene >Pro_DTO377G3_2|g950.t1
ATGTCGACTAGCTTGCCGAATGAAAGATACACAGTCGGATGGGTGTGTGCGCTCCCAATCGAGCTGAGTGCAGCC
AAGGCTATGTTGGACGAGGAGCACGAAGGCCCACAGACACCACCGAAGCAGGCAGATGACAACATTTATTTGCTG
GGAGCCGTGGGAAAATTTAATGTTGTCATCACATGTTTGCCAAAGAACGAGATTGGCTCCAGCTCCGCCGCCGCG
GTTGCCAAGGACATGCTTTTTACCTTTCCTGGCATTCGTTTTGGCTTGATGGTAGGCATTGGAGCAGGAATTCCT
GACTACGAGCTCGATGAGGTCCAAGATGTGCGGCTTGGAGATGTTGTTGTCAGTTCCAGTAAAGAAAATGGTGGA
GTCGTTGTCTATGACTTTGGCAGGAGGCTCGGAGACGGCTCAATCCAGGCCAGGTACCCGTTGAATCAGCCGCCG
AGGTCTCTGAGGACAGCCTTAACCCGGCTGGAGACTGAGCATATGTTGAACGAAAGTCAGGTTGCATCTTTCATT
GAGAAAGCACTCACCAAATACCCGAAGTTGAGAAAAAAAGGTGGTTGGGTCAGGCCGAATCAAGATTCTGATAGG
CTGTTTCACGCCGAATACCCTCACGTTGGTGGAAGAACATGTGCGGAATGCGACAAAGACTATGAGATAGATCGC
CAGGAATGGGAAAGACATGATACCAGCCCGGTGATTCATTATGGAACCATTGCTACAGGCAATGCGGTTGTCAAG
CACGCACCAACACGGACCGAAATTGGAAAAACACATCAGGCCATTTGCTTGGAAATGGAAGCGGCTGGGTTGATG
AACGCCTTTCCCTGCCTTGTTATTCGCGGAATATCCGACTATGCAGATTCCCACAAGAACGACACCTGGCACAAC
TACGCTGCAGTAGCTGCATCGGCTTGTGCCAAAGAGCTGCTGCAATTTGTGACGCCTAAAGAGGTTGAAGCAGAG
GATACTGCGCAAAAAATCTTGAATTCTGGTCAGTATCGAAGCCTGTCCGTTGTCTGGTCGTGATGCCAAGGTAGT
TCAAGTGGCTGATCTACCCTCCGACATGTGTAGTTAGTGAGGACGTATCATCAATCAAAGAAAGTGTTTCTGTCC
TCAATACGGCTGTTCTCGAAGAGCATCAAATGGCCATCCTTGACTGGCTATCCCCACACAACTTCAACGATGTGC
AGAATGATAGACTGGCCCAAAGAATAGACGGAACATGCCTGTGGTTTCTTGAGACCGCTGAAATGAAGAATTGGC
TTCAAAGCGCTGGTCAAACTTTGTTCTGCCCTGGTATCCCGGGCGCTGGGAAGACGGTCATGGCTGCCACCATCA
TTGAGCATCTTCAATCTCTGACGAAGCAAGATCCAAAGTCTGTTGTTGCATATATCTACTGCAGCTATCAGCCAA
AATCTGAACAGGCTGTTCAGAATATGCTACAGGTGCTGCTACGGCAGGTCACTGCCAAGCAGAGAAGCATCCCAG
ACAACATCAAACGCCTCCACAAAGAACATGCCACCGCGGGCTCTCGTCCATCAATCAAACAGCTGTTGGTGGTGC
TTTGCCAATGTCTGAGGCAGTACAACCGTGTGTTCATTGTCCTTGATGCAGTGGACGAATATTATGTCTCGGATT
ACGAGAGCCACCAAACACTGCTTTCTGAGCTATCTGATATCCAAAGGGACATTCCAATCAATTTGCTGATGACTT
CACGGTTCAACAACACGAATGTTTCGTCAAAATTTCCTGGCTCAATACAGAAGGAAATTCGGGCGCACGAAGCCG
ATATCCTCCTATACTTGAATCGGAAGTTGCCAATTTTTGTGGTCAGTGTCGCCGGAAAAGTATATCTCGAAGAAC
ATATCCAATCCATGGTGCTTCAAGCTGCAGACGGAATGTTTCTGCTTGCTCAGCTTCATACAGAGTACCTGATGA
AGATGCCAACGATCCGCCATCTCAAGCGTTCCCTCGAGGCTCTACCCAGAGGTCAGGACGGTTTAACCCCGACTT
ATGTACGAGCGATGTCGGACATTGATCGACAGGCAAATGAAATTCGCGATTTGGCAAGGAAGGCTCTGTCTTGGC
TCGCCCACAGCAAACAAGCACTCAGCTCCGTCGAATTGCAGCATGCATTAGTGACTGAAAGCGGGCAGTCTGACC
TAGATGAAGAGCTTCTGCTGGATATTGATATTCTTCATAATCTGTGTGCGGGACTAATAGTCTGGGATCGAGCAA
CCGATGTTGTGCGCCTCATTCATTACACCACACATGAGTTTCTTCAGACAGAAGGTATTTTGAAGGACCCCGAGA
GTCAAGTAGCGCTAAACTGTCTCACTTACATGTCATTTGAGCCCTTTTCCTTCGGCCGCTGCAGTAACCCAGAAT
CATACATGGATCGGCATGAGCGATATCCCTTGTACATGTATTGCACGAAACACTGGGGAGACCATGCGCGAAATT
CAAATAGCGATGATGCAAAGAATGTTGCGCTTCAGTTTTTAGCCAGCATCGGATGCTTTTCTGCTGCTTGTCAAA
GCATGAAGGGGCCTCCAATCAAGCGGGGCAAACCCCTGGATTCATCAAACATCTTGAAGTACAGTACATGCAGGA
TAACGGCAGCCCATGTTTGCGCATACTTTGGTCTCACTGAATGGCTTCAAATCCTACTTCAAAACGGGGCTGAAG
TCAATGCGAAAGACTCGAAGGGGGACACCCCTTTGACCTACGCTGCACGGGCAGGTCACGAGAGCACCGTCAAGC
TCATCGGGCCTGAAATGAGCCATGGTGTGATTTCAAAAGATGATGCACTGGAGGAAGCTGCTGGTGAAGGGCATG
AAGCCGATGTTAGGTATTTGCTATCCGGTTCCGCCGGTACCGAAGTTGGACAAGAACAGAAGCAGCGGGCACTTA
AGGAAGCTGCTGGAAAGGGTCATGTCTCAATCATGAAGCTCCTCCTTGACCAGGGGACCAATCCTGAATACAATC
ATATCAGGGGTGGTTGGTTCAGAGAGGATAGTCCGCTAGAGCTGGCTATATCTTCGGGAAACCTAGAAGCAGTTC
GCTTACTTCTGCCAAAGGATGGCACTATCAGCGAATACGCTAACAAGAACATGGAGCTGGTTTTTAGAGCAGTGT
CTGATGCGAACTACGAGATGGTTCAACTGTTGCTCAATCATGGAGCTGATCCTGACTTGCCAAATACGAGCGGAC
GAACGCCTTTCATCAAAGCAGTTTTCAAGGGTGAAAAAAGCACAGCGAGACTGCTTCTGAGCAAAGACATTGATG
TCAATGCTCAGGATCAGACTGGTGGCAACCCTTTGATATATTCCGTTCGCAGTGGTGATGAAGAGTTGGTAAATG
CGCTGTTGATGAAAGGCGCTGACCCAAATCTGAGGGCAATCACGTGGGACCTTGAGACTCCATTGGACCGGGCAG
TGTCAAAGGGATATCTGAAAATTGTTCAAGCTCTCATACTCAAAGGGGCAGACCCCAACCAACCAAGCGGCTCCC
TGGAGGATCCCCCTCTGTGCAGTGCCGCAGGGAACGATCATGAAGAGGTTGTGAGATATCTTCTTGAGCGTGGTG
CCGACGTCAATTTGTCAAACAAAGTAAACGAAACACCGTTGTTCTTTGCCATAAAAGCGAGGCGCATCCAGATAT
CAAGACTTTTGTTGAGCGAAGGTGCTAAGCTCGACAGCCAAAACATTGTTGGAAACACAGCTCTCTTTTATGCCG
TCCAATGCCCATCCAACTCACTTGCAGCCGATCTAATCACAAGAGGAAGTGATCCGAATCAAAGGAATGAGTTGG
AAGAGACTCCGCTTTTCTTCGCAGCCAGAGCAGGATCTCTGTCGTCGGTCCACCTTTTACTGAACGGTGGGGCTC
ACGCGGACCCGAGGAACAAATTAAGAGAGACGCCATTACTTCAGGCAGCTACATTCCTTTGTGCTGACAAAGAGT
CTTGCATGGAATATGCCGCCATCATTGAATTGCTTATAGCAAATGGGGCTGATCCCAATCCAACTCCCGATTTAG
GATACCCTCATATCTTATTTGACGCAGTTGGAGACGGGGACTTGGTGAGTCAATGGTCGGAATCGGACCCAGAAA
AGTTCCAACAAGTCCAAGAATCTTGGTCCAAGTCCAAGAGACTTTCAAAAGATCTCTTTGCTTTGTTTTGTGAGC
ATATTTCGGGGAGAAATGGGGAGGGATATTCAAAGTGGAAAAATTCTTGGTCGGCGAGACGTTCTTGGAAAGATG
GTCTAGTGACTCCACTGGTCTGGTCTGTACGTGCGGGCTGCACTGATCTTTCCCGGCGGTTGGTTGATCTAGGGC
TTGATGATATGGACGCTCCTTCTTCGGAGCCTCTGTTGTACAAGGCAGCTGATTTCAAACACAACAAGGTAGCTG
ACCTCATTTATAAGTCAGACCTCCAGGTATATGTTCAGAATATCAAGCCTGGAGAACGCGGAACCGTTGGAAAGC
TAGCGTTTTTGTCGGCAGTGGAGATGGGAAACCTGGCTATTATCTCAGTTCTTCAACGCCATTCGCTGTCTTACC
TCACGTCAACAACTCGTGTTGGGGATTTTGCTCTGCTTGTGTCTTCAAGATGTGGGCGAATTAACCTGTGTCATC
ATCTCATCGATGCAGGCTTTGACCTCCATCATCGCGATGAAACGGGAAAAACCAGCTTGACTTTGGCGTCCATTG
AAGGGCACAATGACCTTGTGGAACTCCTTCTACAGAAAGGGTGTCAAACGGAAGCTGAAGACAATACAGGCCGGA
CTCCGCTCTTGTGGGCTGTGCAACTTGGGAATACACCAGCCGTTGAATTGTTGCTGCGAGCAGGCGCAAATCCCA
ACTGCCTTGAACAGAACAGCCGAACACCTTTGTTGTTCTCCACTCTCAACGGTGACGATTTCATGGTTGAGCTAC
TGCTGAAGTATGGGGCAAATCCAAATTTCGCGAATAAGGCCGGTGAAAGTGCTCTTTCCTGGGCCGTAGCTCAGA
ATTACGAGGCAATTGCAAACATGCTCCTGAAGCGAGAAGCCAGGCTGATCAACGAGAACAATTTGAACCAATCCC
CTCTCTTTTGGTTGATCAGACCTTTCCTCACTAAGAGGGTCAAAAGCAGTTTAACAGTCAGGCGATCCTCATATA
ATCTCAAGCAAAAGGCATTCAACAAGAATGACATCTTTTCTGTGGTGTCCACAGTCCAGGTTGACGGGAAGTCTG
ACTTTGACGGTGATGAGACAGTTGGGAATGATATGGAGGCTATGCTGAGACTGCTCATCTCTCATGGTCAAAACA
TTGATCTCAAAGATGAAAATGGAAGGACATGTCTGGCCAGAGCCGCCTTTGCCCCAAATGAGGATTACGCGAGAA
TATTTTTACGCCACGGCGCAAACCCGGACACACAAAACGATCTCGGCGAGACACCCCTCTTCCTAGCCTCTCTTA
GAAGAGGTGGCTCGTCACCCTCCCCAGCCCAAATGAAAAGAAAGACAGATATGATCGATATCCTGGCTTGCAACG
GTGCCAATCCGAACCTAGCCACCGTGTATGGTCGTACTCCACTGATGACAGTGGCAGCATCAGGGGCATTAGAGG
CCACTCAGATTTTGTTGAAAATCACCAATGTGAATAAACACCTCCAAGATCGCTTTGGGCGCACTGCCTTCTCGG
AAGCTTCCGAGCGAAGCCAACCACACATCTGTGGTCTATTAGACCCGGATGAGGTGGATCATGACTTGCCGGTAC
CAGAGACTGTCCATCAAATGGCCTCGCCCAAATTCTGTGACATTTGCCGGGTAAACATCTGCAGTGGGGACGAGT
TTTACCACTGTGAGCTTTGCCAGGGTGGGGACTATGATGTCTGCAATTTCTGTCTCCGAAATGGTGCATCTTGCT
TGGATGAAACGCATCCGGTTTCGAAAATTATAGCGGTCCCCCGAAAAGCCATCGAACCGAAGAACTCTACCACGG
AGGATCCATCTTCTTTAATGGCAGCTCACATGGCCTCGCTCATGATGGCCTCAATTCAGTCGATGATTGGAAAGT
GCAGCACGTCGTCCCAGTCTGGATCCTCAGAGAGCAGGGACGCATCTAATCGACTGAGAGTGAGAATGTGGCGAC
CCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail