Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9481.t1
Gene name
Locationscaffold_48:117875..118529
Strand+
Gene length (bp)654
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 110 132 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9481.t1
MAESFAILRQRRSNELTSLANEHLQHDLNAEDRDKLNAASRSISTWTAIGSGVGITLGLVAAIRFRNSRKAFFSA
IRAQDRPTKVMFEDGRTEAIPDLTPLLKPTTLGDFATYFLAAAGGLFLGGELGFAGGVAKGTWSLDADPQSKERI
ETAFRKFRADVLRKQADAFDKGENNSYLL*
Coding >Pro_DTO377G3_2|g9481.t1
ATGGCCGAATCATTCGCTATCCTCCGCCAACGCCGCTCCAACGAGCTAACCAGCCTCGCCAACGAGCACCTCCAA
CACGACCTCAATGCCGAAGACCGCGACAAGCTCAACGCAGCCTCGAGATCAATCTCCACGTGGACGGCCATTGGG
TCCGGCGTCGGTATTACCCTCGGTCTTGTCGCCGCCATCCGCTTCCGCAACTCGCGCAAGGCGTTCTTCTCAGCC
ATTCGCGCGCAGGATAGACCTACCAAGGTTATGTTTGAGGATGGACGGACTGAGGCTATTCCGGACCTCACGCCG
CTGTTGAAGCCTACTACTCTCGGTGATTTCGCGACTTATTTCCTTGCCGCGGCTGGTGGGTTGTTCTTGGGTGGA
GAGCTTGGCTTTGCTGGTGGTGTGGCGAAAGGGACGTGGAGTCTCGACGCGGATCCCCAGAGCAAGGAGAGAATT
GAGACTGCTTTCAGGAAATTCCGCGCTGATGTGCTGCGGAAACAGGCTGATGCTTTTGATAAGGGGGAGAATAAT
TCCTATCTCCTCTAG
Transcript >Pro_DTO377G3_2|g9481.t1
ATGGCCGAATCATTCGCTATCCTCCGCCAACGCCGCTCCAACGAGCTAACCAGCCTCGCCAACGAGCACCTCCAA
CACGACCTCAATGCCGAAGACCGCGACAAGCTCAACGCAGCCTCGAGATCAATCTCCACGTGGACGGCCATTGGG
TCCGGCGTCGGTATTACCCTCGGTCTTGTCGCCGCCATCCGCTTCCGCAACTCGCGCAAGGCGTTCTTCTCAGCC
ATTCGCGCGCAGGATAGACCTACCAAGGTTATGTTTGAGGATGGACGGACTGAGGCTATTCCGGACCTCACGCCG
CTGTTGAAGCCTACTACTCTCGGTGATTTCGCGACTTATTTCCTTGCCGCGGCTGGTGGGTTGTTCTTGGGTGGA
GAGCTTGGCTTTGCTGGTGGTGTGGCGAAAGGGACGTGGAGTCTCGACGCGGATCCCCAGAGCAAGGAGAGAATT
GAGACTGCTTTCAGGAAATTCCGCGCTGATGTGCTGCGGAAACAGGCTGATGCTTTTGATAAGGGGGAGAATAAT
TCCTATCTCCTCTAG
Gene >Pro_DTO377G3_2|g9481.t1
ATGGCCGAATCATTCGCTATCCTCCGCCAACGCCGCTCCAACGAGCTAACCAGCCTCGCCAACGAGCACCTCCAA
CACGACCTCAATGCCGAAGACCGCGACAAGCTCAACGCAGCCTCGAGATCAATCTCCACGTGGACGGCCATTGGG
TCCGGCGTCGGTATTACCCTCGGTCTTGTCGCCGCCATCCGCTTCCGCAACTCGCGCAAGGCGTTCTTCTCAGCC
ATTCGCGCGCAGGATAGACCTACCAAGGTTATGTTTGAGGATGGACGGACTGGTATGTTATTTTGATTGTAATGA
AACAAAGATCGGTATTAATTTGTGTCTTGTGTGTAGAGGCTATTCCGGACCTCACGCCGCTGTTGAAGCCTACTA
CTCTCGGTGATTTCGCGACTTATTTCCTTGCCGCGGCTGGTGGGTTGTTCTTGGGTGGAGAGCTTGGTAAGATTG
TCGATCGTATGATGCCGAGTTGAATTGTGCTAATGGAATTCTGTAGGCTTTGCTGGTGGTGTGGCGAAAGGGACG
TGGAGTCTCGACGCGGATCCCCAGAGCAAGGAGAGAATTGAGACTGCTTTCAGGAAATTCCGCGCTGATGTGCTG
CGGAAACAGGCTGATGCTTTTGATAAGGGGGAGAATAATTCCTATCTCCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail