Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9475.t1
Gene nametspB
Locationscaffold_48:105348..107038
Strand+
Gene length (bp)1690
Transcript length (bp)1425
Coding sequence length (bp)1425
Protein length (aa) 475

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00982 Glyco_transf_20 Glycosyltransferase family 20 6.5E-154 10 469

GO

GO Term Description Terminal node
GO:0005992 trehalose biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0005984 disaccharide metabolic process No
GO:0016051 carbohydrate biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0005991 trehalose metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0044238 primary metabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:0009987 cellular process No
GO:0046351 disaccharide biosynthetic process No
GO:0005975 carbohydrate metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0009312 oligosaccharide biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9475.t1
MAPHEQNEQRLIITSNRLPLSVKSKDDTYEAIPSSGGLVTALNGLSFHAYLWLGWPGVDINERDRESVDKALAKE
NASAVYLDESLAQSHYNGFSNGVLWPTLHYQSDASFDNESWDAYQRVNTIFADRISEEAADGDLIWVHDYHLLLL
PRLLRERLHAQNKRCAIGFSLHTPFPADDFWRGLPVQKALLDGVLGSDLVGFHTDEYKTNFAGACRSHIGAEIEG
DNIYYNDHTISIDKYVVGIDCQRFADALDDPEVQAEIQQIENQYKDKTIIIGVDRMDYTKGLPEKLQGFRVFLDQ
YPEWSKKVVLIQIAIPSREDVKKYQDLEGEVSKLVGQITGQYATPTSTPLIYIHRSVSFAELTALYSVSDVCLLT
SRRDGMNLVASEYVACQEARHGVLVLSEFTGASAFMKGGSLLFNPSSADSLSNALYEAVTMEKEDRKKMYEELRS
FVTTNTSANWTETFVGDLTKLQNR*
Coding >Pro_DTO377G3_2|g9475.t1
ATGGCACCCCATGAGCAAAACGAGCAGAGACTCATAATTACCTCAAATCGCCTTCCACTTTCCGTCAAATCCAAA
GACGACACTTACGAGGCGATTCCCTCCAGCGGGGGATTGGTGACCGCTCTAAATGGTTTGAGCTTTCATGCCTAT
CTGTGGCTAGGCTGGCCCGGGGTCGATATCAATGAACGGGACAGAGAAAGCGTCGACAAAGCCCTGGCCAAAGAA
AATGCCTCTGCAGTATACCTAGATGAGAGCCTCGCTCAGAGTCATTACAATGGATTCTCTAACGGTGTTTTATGG
CCCACGTTACATTATCAGTCGGATGCGTCCTTCGATAACGAGTCATGGGACGCGTACCAGCGTGTAAATACGATA
TTCGCTGATCGAATCAGTGAGGAGGCGGCGGATGGTGACCTAATATGGGTTCACGACTATCACCTACTCCTGCTG
CCACGTCTACTGCGTGAGCGCCTCCATGCGCAAAACAAAAGATGCGCTATAGGATTTTCTTTGCACACCCCTTTC
CCAGCAGATGATTTTTGGAGAGGTCTTCCTGTTCAGAAAGCGTTGCTCGATGGTGTCCTTGGTAGCGACCTCGTC
GGCTTCCATACGGACGAGTATAAGACGAACTTCGCTGGCGCCTGCAGATCTCACATTGGTGCAGAAATTGAAGGC
GACAATATCTACTACAACGACCACACTATTAGCATTGATAAATATGTCGTTGGGATTGACTGCCAGAGATTTGCT
GATGCACTCGATGATCCTGAGGTTCAGGCTGAAATTCAGCAGATTGAAAACCAATATAAGGACAAAACGATCATA
ATCGGCGTGGACCGCATGGACTACACGAAAGGATTGCCCGAAAAATTGCAGGGCTTCCGAGTCTTCCTCGATCAA
TACCCCGAATGGAGTAAAAAGGTTGTGCTAATACAGATCGCCATTCCCAGTCGCGAAGATGTCAAGAAATACCAG
GATTTGGAGGGGGAAGTGAGCAAATTGGTGGGCCAAATCACTGGGCAATATGCTACTCCCACGTCGACACCATTG
ATCTATATTCACCGCTCAGTTTCTTTTGCGGAGCTTACAGCTCTATATTCGGTGTCTGATGTCTGTCTCCTCACT
TCCCGCCGGGACGGAATGAACCTTGTTGCTTCCGAGTATGTCGCTTGCCAAGAGGCTCGACACGGTGTGTTGGTG
CTCTCTGAGTTTACCGGTGCATCGGCCTTTATGAAAGGCGGCAGTCTGTTGTTCAATCCTTCTAGTGCAGATAGC
CTCTCAAATGCGCTTTACGAGGCTGTTACAATGGAGAAGGAGGATAGGAAGAAGATGTACGAAGAGTTGCGGAGT
TTTGTCACCACCAATACCAGTGCGAACTGGACGGAGACTTTCGTTGGAGATTTGACGAAATTGCAGAATAGATAG
Transcript >Pro_DTO377G3_2|g9475.t1
ATGGCACCCCATGAGCAAAACGAGCAGAGACTCATAATTACCTCAAATCGCCTTCCACTTTCCGTCAAATCCAAA
GACGACACTTACGAGGCGATTCCCTCCAGCGGGGGATTGGTGACCGCTCTAAATGGTTTGAGCTTTCATGCCTAT
CTGTGGCTAGGCTGGCCCGGGGTCGATATCAATGAACGGGACAGAGAAAGCGTCGACAAAGCCCTGGCCAAAGAA
AATGCCTCTGCAGTATACCTAGATGAGAGCCTCGCTCAGAGTCATTACAATGGATTCTCTAACGGTGTTTTATGG
CCCACGTTACATTATCAGTCGGATGCGTCCTTCGATAACGAGTCATGGGACGCGTACCAGCGTGTAAATACGATA
TTCGCTGATCGAATCAGTGAGGAGGCGGCGGATGGTGACCTAATATGGGTTCACGACTATCACCTACTCCTGCTG
CCACGTCTACTGCGTGAGCGCCTCCATGCGCAAAACAAAAGATGCGCTATAGGATTTTCTTTGCACACCCCTTTC
CCAGCAGATGATTTTTGGAGAGGTCTTCCTGTTCAGAAAGCGTTGCTCGATGGTGTCCTTGGTAGCGACCTCGTC
GGCTTCCATACGGACGAGTATAAGACGAACTTCGCTGGCGCCTGCAGATCTCACATTGGTGCAGAAATTGAAGGC
GACAATATCTACTACAACGACCACACTATTAGCATTGATAAATATGTCGTTGGGATTGACTGCCAGAGATTTGCT
GATGCACTCGATGATCCTGAGGTTCAGGCTGAAATTCAGCAGATTGAAAACCAATATAAGGACAAAACGATCATA
ATCGGCGTGGACCGCATGGACTACACGAAAGGATTGCCCGAAAAATTGCAGGGCTTCCGAGTCTTCCTCGATCAA
TACCCCGAATGGAGTAAAAAGGTTGTGCTAATACAGATCGCCATTCCCAGTCGCGAAGATGTCAAGAAATACCAG
GATTTGGAGGGGGAAGTGAGCAAATTGGTGGGCCAAATCACTGGGCAATATGCTACTCCCACGTCGACACCATTG
ATCTATATTCACCGCTCAGTTTCTTTTGCGGAGCTTACAGCTCTATATTCGGTGTCTGATGTCTGTCTCCTCACT
TCCCGCCGGGACGGAATGAACCTTGTTGCTTCCGAGTATGTCGCTTGCCAAGAGGCTCGACACGGTGTGTTGGTG
CTCTCTGAGTTTACCGGTGCATCGGCCTTTATGAAAGGCGGCAGTCTGTTGTTCAATCCTTCTAGTGCAGATAGC
CTCTCAAATGCGCTTTACGAGGCTGTTACAATGGAGAAGGAGGATAGGAAGAAGATGTACGAAGAGTTGCGGAGT
TTTGTCACCACCAATACCAGTGCGAACTGGACGGAGACTTTCGTTGGAGATTTGACGAAATTGCAGAATAGATAG
Gene >Pro_DTO377G3_2|g9475.t1
ATGGCACCCCATGAGCAAAACGAGCAGAGACTCATAATTACCTCAAATCGCCTTCCACTTTCCGTCAAATCCAAA
GACGACACTTACGAGGCGATTCCCTCCAGCGGGGGATTGGTGACCGCTCTAAATGGTTTGAGCTTTCATGCCTAT
CTGTGGCTAGGCTGGCCCGGGGTCGATATCAATGAACGGGACAGAGAAAGCGTCGACAAAGCCCTGGCCAAAGAA
AATGCCTCTGCAGTATACCTAGATGAGAGCCTCGCTCAGAGTCATTACAATGGATTCTCTAGTACGTGGCCTATA
TTCTCGGGTATATTACTACCTCGCTGACTAGGCGTATTTAGACGGTGTTTTATGGCCCACGTTACATTATCAGTC
GGATGCGTCCTTCGATAACGAGTCATGGGACGCGTACCAGCGTGTAAATACGATATTCGCTGATCGAATCAGTGA
GGAGGCGGCGGATGGTGACCTAATATGGGTTCACGACTATCACCTACTCCTGCTGCCACGTCTACTGCGTGAGCG
CCTCCATGCGCAAAACAAAAGATGCGCTATAGGATTTTCTTTGCACACCCCTTTCCCAGCAGATGATTTTTGGAG
AGGTCTTCCTGTTCAGAAAGCGTTGCTCGATGGTGTCCTTGGTAGCGACCTCGTCGGCTTCCATACGGACGAGTA
TAAGACGAACTTCGCTGGCGCCTGCAGATCTCACATGTAAGGTCCGGGAAATAGCATTGAAATACCAAGTGACTA
ACCAATTTATTAGTGGTGCAGAAATTGAAGGCGACAATATCTACTACAACGACCACACTATTAGCATTGATAAAT
ATGTCGTTGGGATTGACTGCCAGAGATTTGCTGATGCACTCGATGATCCTGAGGTTCAGGCTGAAATTCAGCAGA
TTGAAAACCAATATAAGGACAAAACGATCATAATCGGCGTGGACCGCATGGACTACACGAAAGGATTGCCCGAAA
AATTGCAGGGCTTCCGAGTCTTCCTCGATCAATACCCCGAATGGAGTAAAAAGGTTGTGCTAATACAGATCGCCA
TTCCCAGTCGCGAAGATGTCAAGAAATACCAGGATTTGGAGGGGGAAGTGAGCAAATTGGTGGGCCAAATCACTG
GGCAATATGGTAAGTGGGTGCCCACTTCTGGTATAGGGTATGGCAGGTCTGTAGATTTCAAGCTAAATAACAATC
AGCTACTCCCACGTCGACACCATTGATCTATATTCACCGCTCAGTTTCTTTTGCGGAGCTTACAGCTCTATATTC
GGTGTCTGATGTCTGTCTCCTCACTTCCCGCCGGGACGGAATGAACCTTGTTGCTTCCGAGTATGTCGCTTGCCA
AGAGGCTCGACACGGTGTGTTGGTGCTCTCTGAGTTTACCGGTGCATCGGCCTTTATGAAAGGCGGCAGTCTGTT
GTTCAATCCTTCTAGTGCAGATAGCCTCTCAAATGCGCTTTACGAGGCTGTTACAATGGAGAAGGAGGATAGGAA
GAAGATGTACGAAGAGTTGCGGAGTTTTGTCACCACCAATACCAGGTTAGTTGTTTCCTTTCATCTTCTCAAATT
CCCTCACCTGCCATCAGAGGTCCCTCAGGTCTTGTAATCAGCAAAACTAACGCCCTTCAGTGCGAACTGGACGGA
GACTTTCGTTGGAGATTTGACGAAATTGCAGAATAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail