Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9464.t1
Gene name
Locationscaffold_48:78183..79381
Strand+
Gene length (bp)1198
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.1E-05 7 44
PF00106 adh_short short chain dehydrogenase 3.0E-20 55 206
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 4.9E-23 12 200
PF08659 KR KR domain 4.9E-05 8 110

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 10.64 3.84 17.43
5d_25C Five days - 25 degrees Celsius 11.20 4.00 18.40
7d_25C Seven days - 25 degrees Celsius 11.60 3.85 19.34
10d_25C Ten days - 25 degrees Celsius 7.36 2.25 12.47
7d_15C Seven days - 15 degrees Celsius 16.70 6.40 27.00
7d_30C Seven days - 30 degrees Celsius 17.61 7.46 27.75

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.926712 no
3d_25C 7d_25C 0.876511 no
3d_25C 7d_15C 0.232656 no
3d_25C 7d_30C 0.149515 no
3d_25C 10d_25C 0.374080 no
5d_25C 7d_25C 0.952757 no
5d_25C 7d_15C 0.296401 no
5d_25C 7d_30C 0.201552 no
5d_25C 10d_25C 0.288162 no
7d_25C 7d_15C 0.375489 no
7d_25C 7d_30C 0.272394 no
7d_25C 10d_25C 0.262088 no
7d_15C 7d_30C 0.919573 no
7d_15C 10d_25C 0.019624 yes
7d_30C 10d_25C 0.007779 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9464.t1
MSQTQQVTLIIGASRGIGRQIAIDLAKNGYAVMLSAKTTSDASTVTPFPPDPNSSQSTINTVEREIHEAGGHAAT
VAVDVRDAAQIQHAVDETVRVFGKLDVLVYNSGAIWWSSVEKTPLKRFKLMQQVNPEGLYASVQAALPFFEKGGW
KGRIIVVSPPIYSRFFSGKTAYAMGKVAMSVLVKGLAMDFVRQGRNEMAVTSIWPASSIESAATEYNKGSDTSYK
KDLRKPTIFSDAVLAMLRAPHQTVNGLLDTDEDFLREKCGVSDFSKYSVIPGSTPRRIMPAKFPVLEIAEQDDEG
QRMDSTKLRAKI*
Coding >Pro_DTO377G3_2|g9464.t1
ATGTCCCAAACACAGCAAGTCACCCTGATAATAGGAGCATCACGCGGGATCGGGCGCCAAATTGCCATCGACCTA
GCAAAGAACGGCTACGCCGTAATGCTATCCGCAAAAACAACATCGGACGCATCGACAGTGACTCCGTTCCCACCA
GACCCGAACTCATCGCAGTCTACCATCAACACAGTAGAGCGCGAGATTCACGAAGCGGGCGGACACGCGGCAACA
GTCGCCGTTGACGTGCGTGACGCCGCACAGATCCAGCATGCTGTCGACGAGACGGTTCGCGTCTTTGGGAAGCTC
GATGTGCTCGTGTACAACTCCGGTGCGATCTGGTGGTCTTCTGTGGAGAAGACGCCTCTGAAGCGGTTTAAGCTT
ATGCAGCAGGTCAACCCCGAGGGACTGTATGCGAGTGTTCAAGCTGCTTTGCCTTTCTTTGAGAAGGGGGGCTGG
AAAGGGCGCATTATTGTTGTATCGCCGCCTATTTACTCGAGGTTCTTTAGTGGGAAGACTGCTTATGCGATGGGC
AAAGTCGCAATGAGTGTCTTGGTCAAAGGACTGGCCATGGACTTTGTACGCCAAGGCCGAAATGAAATGGCGGTG
ACGAGTATCTGGCCTGCATCGTCGATTGAATCAGCAGCTACAGAGTATAATAAGGGATCCGACACATCCTACAAA
AAGGATTTGAGAAAACCGACGATATTCTCAGATGCTGTTCTGGCTATGCTTCGTGCCCCACATCAAACAGTGAAT
GGGCTCCTGGATACAGATGAGGACTTTCTCAGGGAGAAATGCGGAGTCTCTGACTTTTCCAAATACTCTGTAATC
CCAGGATCGACGCCACGGCGGATCATGCCGGCCAAGTTCCCAGTCTTGGAGATTGCAGAGCAAGACGATGAAGGG
CAGCGAATGGATAGCACGAAGTTACGGGCCAAGATATAG
Transcript >Pro_DTO377G3_2|g9464.t1
ATGTCCCAAACACAGCAAGTCACCCTGATAATAGGAGCATCACGCGGGATCGGGCGCCAAATTGCCATCGACCTA
GCAAAGAACGGCTACGCCGTAATGCTATCCGCAAAAACAACATCGGACGCATCGACAGTGACTCCGTTCCCACCA
GACCCGAACTCATCGCAGTCTACCATCAACACAGTAGAGCGCGAGATTCACGAAGCGGGCGGACACGCGGCAACA
GTCGCCGTTGACGTGCGTGACGCCGCACAGATCCAGCATGCTGTCGACGAGACGGTTCGCGTCTTTGGGAAGCTC
GATGTGCTCGTGTACAACTCCGGTGCGATCTGGTGGTCTTCTGTGGAGAAGACGCCTCTGAAGCGGTTTAAGCTT
ATGCAGCAGGTCAACCCCGAGGGACTGTATGCGAGTGTTCAAGCTGCTTTGCCTTTCTTTGAGAAGGGGGGCTGG
AAAGGGCGCATTATTGTTGTATCGCCGCCTATTTACTCGAGGTTCTTTAGTGGGAAGACTGCTTATGCGATGGGC
AAAGTCGCAATGAGTGTCTTGGTCAAAGGACTGGCCATGGACTTTGTACGCCAAGGCCGAAATGAAATGGCGGTG
ACGAGTATCTGGCCTGCATCGTCGATTGAATCAGCAGCTACAGAGTATAATAAGGGATCCGACACATCCTACAAA
AAGGATTTGAGAAAACCGACGATATTCTCAGATGCTGTTCTGGCTATGCTTCGTGCCCCACATCAAACAGTGAAT
GGGCTCCTGGATACAGATGAGGACTTTCTCAGGGAGAAATGCGGAGTCTCTGACTTTTCCAAATACTCTGTAATC
CCAGGATCGACGCCACGGCGGATCATGCCGGCCAAGTTCCCAGTCTTGGAGATTGCAGAGCAAGACGATGAAGGG
CAGCGAATGGATAGCACGAAGTTACGGGCCAAGATATAG
Gene >Pro_DTO377G3_2|g9464.t1
ATGTCCCAAACACAGCAAGTCACCCTGATAATAGGAGCATCACGCGGGATCGGGCGCCAAATTGCCATCGACCTA
GCAAAGAACGGCTACGCCGGTACAGCCACATGCAATCCCACATAGACCATCGAGACTAACCCCAAACCCCAGTAA
TGCTATCCGCAAAAACAACATCGGACGCATCGACAGTGACTCCGTTCCCACCAGACCCGAACTCATCGCAGTCTA
CCATCAACACAGTAGAGCGCGAGATTCACGAAGCGGGCGGACACGCGGCAACAGTCGCCGTTGACGTGCGTGACG
CCGCACAGATCCAGCATGCTGTCGACGAGACGGTTCGCGTCTTTGGGAAGCTCGATGTGCTCGTGTACAACTCCG
GTGCGATCTGGTGGTCTTCTGTGGAGAAGACGCCTCTGAAGCGGTTTAAGCTTATGCAGCAGGTCAACCCCGAGG
GACTGTATGCGAGTGTTCAAGCTGCTTTGCCTTTCTTTGAGAAGGGGGGCTGGAAAGGGCGCATTATTGTTGTAT
CGCCGCCTATTTACTCGAGGTTCTTTAGTGGGAAGACTGCTTATGCGATGGGTGAGTTACCCTTGATACGTGGGG
TAGAGGATCCACATAGAGTGTGTGCTGATGATGTGTTGTATGTAGGCAAAGTCGCAATGAGTGTCTTGGTCAAAG
GACTGGCCATGGACTTTGTACGCCAAGGCCGAAATGAAATGGCGGTGACGAGTATCTGGCCTGCATCGGTATGTG
TCTTGGTCTTGATTCCATCCGGACGTGGAGTGCATGAGGGGATTGCTGACTGCATCATTACTTCCTAGTCGATTG
AATCAGCAGCTACAGAGTATAATAAGGGATCCGACACATCCTACAAAAAGGATTTGAGAAAACCGGTATGTCCAT
TTCGATACTGTCTACACTTCCTGGTCAATTCAATACTGACACGATGCAATAGACGATATTCTCAGATGCTGTTCT
GGCTATGCTTCGTGCCCCACATCAAACAGTGAATGGGCTCCTGGATACAGATGAGGACTTTCTCAGGGAGAAATG
CGGAGTCTCTGACTTTTCCAAATACTCTGTAATCCCAGGATCGACGCCACGGCGGATCATGCCGGCCAAGTTCCC
AGTCTTGGAGATTGCAGAGCAAGACGATGAAGGGCAGCGAATGGATAGCACGAAGTTACGGGCCAAGATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail