Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g946.t1
Gene name
Locationscaffold_01:2501888..2504122
Strand-
Gene length (bp)2234
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 3.8E-13 154 407
PF06723 MreB_Mbl MreB/Mbl protein 4.0E-05 166 404
PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain 2.4E-04 345 408

GO

GO Term Description Terminal node
GO:0016773 phosphotransferase activity, alcohol group as acceptor Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0000902 cell morphogenesis Yes
GO:0048869 cellular developmental process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016043 cellular component organization No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0009653 anatomical structure morphogenesis No
GO:0032989 cellular component morphogenesis No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0032502 developmental process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g946.t1
MEAKHGYKLVVGVDYGTTFTEIAYVLTTHAGGQADIDSIDFIKQWPPDIIGQAKTPSLISYMQDGGAPLWGFEVT
QDVRSYAWTKLLLDANFPSSSKFDDTFLKIATASKILELPDQKEAVDTVQDYLSQIYTHIQSYISAELDLSGVPI
DFWFTTPASWSEDTQNLMRQAIQGAGFGKRPQHRVWTIPEPEAAALAVFSDKRVSFKPRDGILICDCGGGTVDIT
TYYVTDVDPTISLEQITTVMGANCGGTAIDSRFYELLSTRVEGGFDSLSLSEIRPGSRAMKKFERIKTHFNSATS
QSWHFDFNLNSQSPSQRRGRVVLQAEDVRDLYEPVLRNIFDLILSQITAANEKCGRHVIKKVVLVGGFSASSYLQ
ESLGSALNRIGISVLIPENPEEAIARGAAVQGLRGYSLPTYKCWRNYGLASFQSFSHPNEPQFLGYGPSALSVNL
LPCWVLRKDQNYPKGFQSTHSIQVLHWEHDLLTKPVEIYESNLSDAPERFENSDAHCIDYIQCHFDHLDLASFPH
RTIAGHTVYYLELLIQVSVSMTDRVIHFSAFANGNVIGQKDLVMAHD*
Coding >Pro_DTO377G3_2|g946.t1
ATGGAAGCTAAGCATGGGTACAAGCTTGTTGTGGGTGTGGACTACGGTACCACCTTCACAGAAATCGCATATGTC
CTTACAACTCATGCAGGCGGTCAAGCAGATATTGACAGTATCGATTTTATCAAGCAGTGGCCTCCAGATATTATT
GGTCAGGCCAAAACCCCATCCCTAATTTCATATATGCAGGACGGAGGAGCCCCTCTCTGGGGCTTTGAGGTCACG
CAAGATGTACGATCATATGCCTGGACGAAGCTGCTATTGGACGCAAACTTTCCAAGTAGCAGCAAGTTCGACGAT
ACATTCCTGAAGATCGCCACTGCTTCAAAGATTCTGGAGCTGCCTGACCAGAAGGAAGCCGTGGACACTGTGCAA
GATTATCTTTCTCAGATCTACACACACATCCAGAGCTATATCTCCGCCGAACTGGATCTAAGTGGAGTGCCGATC
GATTTCTGGTTCACGACGCCGGCCAGCTGGTCCGAAGACACGCAGAACCTCATGCGTCAAGCAATCCAAGGAGCC
GGCTTTGGAAAAAGGCCTCAACATCGAGTGTGGACCATACCGGAACCAGAGGCTGCAGCTCTTGCTGTTTTCAGT
GACAAAAGGGTCAGTTTCAAGCCTCGTGATGGAATTCTGATCTGTGACTGTGGAGGTGGTACAGTGGATATCACA
ACATACTATGTCACAGACGTTGATCCGACAATCTCCCTTGAGCAGATCACCACCGTTATGGGGGCTAACTGTGGT
GGGACTGCTATTGACAGTCGATTCTATGAACTACTGTCCACTAGAGTTGAAGGGGGATTCGATTCCCTATCCCTG
AGCGAGATCCGACCAGGGAGCCGCGCCATGAAAAAGTTTGAAAGGATCAAGACTCATTTCAATAGTGCAACGAGT
CAGTCTTGGCACTTTGATTTCAACTTGAATTCCCAGTCTCCCAGCCAAAGACGAGGACGTGTTGTTCTTCAAGCC
GAAGATGTCCGAGACCTATACGAGCCTGTTCTGAGAAATATTTTCGACTTGATTCTGTCCCAGATCACTGCTGCA
AATGAGAAGTGTGGACGGCATGTCATCAAAAAAGTTGTCTTGGTTGGCGGATTCAGCGCCTCATCCTATCTGCAG
GAAAGCCTAGGATCTGCCCTCAATCGCATCGGCATTTCCGTGCTTATTCCTGAGAACCCGGAGGAGGCTATCGCT
CGTGGGGCAGCAGTCCAAGGCCTTCGGGGCTACTCTCTTCCGACCTACAAGTGCTGGCGAAATTACGGCCTCGCA
TCGTTTCAAAGTTTCTCCCACCCCAATGAACCGCAATTCCTGGGATATGGGCCTAGCGCACTATCGGTGAATTTG
CTCCCCTGTTGGGTGTTACGCAAGGACCAGAACTACCCAAAGGGATTTCAGTCCACCCATAGCATCCAGGTACTT
CATTGGGAGCATGATCTTCTTACCAAACCCGTGGAGATTTATGAGTCCAATCTCTCAGATGCACCAGAGCGGTTT
GAAAACTCCGATGCTCATTGCATCGATTATATTCAATGTCACTTCGATCACCTTGACCTTGCCTCGTTTCCTCAC
CGAACCATCGCCGGACATACCGTCTATTACTTGGAGCTTTTGATCCAGGTATCTGTGTCAATGACCGATCGGGTG
ATACATTTCAGTGCATTTGCAAATGGTAATGTAATAGGACAAAAGGACCTGGTCATGGCCCATGATTGA
Transcript >Pro_DTO377G3_2|g946.t1
ATGGAAGCTAAGCATGGGTACAAGCTTGTTGTGGGTGTGGACTACGGTACCACCTTCACAGAAATCGCATATGTC
CTTACAACTCATGCAGGCGGTCAAGCAGATATTGACAGTATCGATTTTATCAAGCAGTGGCCTCCAGATATTATT
GGTCAGGCCAAAACCCCATCCCTAATTTCATATATGCAGGACGGAGGAGCCCCTCTCTGGGGCTTTGAGGTCACG
CAAGATGTACGATCATATGCCTGGACGAAGCTGCTATTGGACGCAAACTTTCCAAGTAGCAGCAAGTTCGACGAT
ACATTCCTGAAGATCGCCACTGCTTCAAAGATTCTGGAGCTGCCTGACCAGAAGGAAGCCGTGGACACTGTGCAA
GATTATCTTTCTCAGATCTACACACACATCCAGAGCTATATCTCCGCCGAACTGGATCTAAGTGGAGTGCCGATC
GATTTCTGGTTCACGACGCCGGCCAGCTGGTCCGAAGACACGCAGAACCTCATGCGTCAAGCAATCCAAGGAGCC
GGCTTTGGAAAAAGGCCTCAACATCGAGTGTGGACCATACCGGAACCAGAGGCTGCAGCTCTTGCTGTTTTCAGT
GACAAAAGGGTCAGTTTCAAGCCTCGTGATGGAATTCTGATCTGTGACTGTGGAGGTGGTACAGTGGATATCACA
ACATACTATGTCACAGACGTTGATCCGACAATCTCCCTTGAGCAGATCACCACCGTTATGGGGGCTAACTGTGGT
GGGACTGCTATTGACAGTCGATTCTATGAACTACTGTCCACTAGAGTTGAAGGGGGATTCGATTCCCTATCCCTG
AGCGAGATCCGACCAGGGAGCCGCGCCATGAAAAAGTTTGAAAGGATCAAGACTCATTTCAATAGTGCAACGAGT
CAGTCTTGGCACTTTGATTTCAACTTGAATTCCCAGTCTCCCAGCCAAAGACGAGGACGTGTTGTTCTTCAAGCC
GAAGATGTCCGAGACCTATACGAGCCTGTTCTGAGAAATATTTTCGACTTGATTCTGTCCCAGATCACTGCTGCA
AATGAGAAGTGTGGACGGCATGTCATCAAAAAAGTTGTCTTGGTTGGCGGATTCAGCGCCTCATCCTATCTGCAG
GAAAGCCTAGGATCTGCCCTCAATCGCATCGGCATTTCCGTGCTTATTCCTGAGAACCCGGAGGAGGCTATCGCT
CGTGGGGCAGCAGTCCAAGGCCTTCGGGGCTACTCTCTTCCGACCTACAAGTGCTGGCGAAATTACGGCCTCGCA
TCGTTTCAAAGTTTCTCCCACCCCAATGAACCGCAATTCCTGGGATATGGGCCTAGCGCACTATCGGTGAATTTG
CTCCCCTGTTGGGTGTTACGCAAGGACCAGAACTACCCAAAGGGATTTCAGTCCACCCATAGCATCCAGGTACTT
CATTGGGAGCATGATCTTCTTACCAAACCCGTGGAGATTTATGAGTCCAATCTCTCAGATGCACCAGAGCGGTTT
GAAAACTCCGATGCTCATTGCATCGATTATATTCAATGTCACTTCGATCACCTTGACCTTGCCTCGTTTCCTCAC
CGAACCATCGCCGGACATACCGTCTATTACTTGGAGCTTTTGATCCAGGTATCTGTGTCAATGACCGATCGGGTG
ATACATTTCAGTGCATTTGCAAATGGTAATGTAATAGGACAAAAGGACCTGGTCATGGCCCATGATTGA
Gene >Pro_DTO377G3_2|g946.t1
ATGGAAGCTAAGCATGGGTACAAGCTTGTTGTGGGTGTGGACTACGGTACCACCTTCACAGGTAAGCAAATACAT
TTTCCTTCAACAAACCATTCATTTCTTTCACTAACGAATTCTCTTGGGAAATAGAAATCGCATATGTCCTTACAA
CTCATGCAGGCGGTCAAGCAGATATTGACAGTATCGATTTTATCAAGCAGTGGCCTCCAGATATTATTGGTCAGG
CCAAAACCCCATCCCTAATTTCATATATGCAGGACGGAGGAGCCCCTCTCTGGGGCTTTGAGGTCACGCAAGATG
TACGATCATATGCCTGGACGAAGCTGCTATTGGACGCAAACTTTCCAAGTAGCAGCAAGTTCGACGATACATTCC
TGAAGATCGCCACTGCTTCAAAGATTCTGGAGCTGCCTGACCAGAAGGAAGCCGTGGACACTGTGCAAGATTATC
TTTCTCAGATCTACACACACATCCAGAGCTATATCTCCGCCGAACTGGATCTAAGTGGAGTGCCGATCGATTTCT
GGTTCACGACGCCGGCCAGCTGGTCCGAAGACACGCAGAACCTCATGCGTCAAGCAATCCAAGGAGCCGGCTTTG
GAAAAAGGCCTCAACATCGAGTGTGGACCATACCGGAACCAGAGGCTGCAGCTCTTGCTGTTTTCAGTGACAAAA
GGGTCAGTTTCAAGGTAAGTAAAAATTCTCAACTCGGTGTCTTCGGTTCGTTTAGCTAAACATCTTATCCATTCA
ACCCTTAGCCTCGTGATGGAATTCTGATCTGTGACTGTGGAGGTGGTACAGTGGTGAGATACCCGATTATACCGT
TGAAACTTCATAATCTTACACTGTGATTAGGATATCACAACATACTATGTCACAGACGTTGATCCGACAATCTCC
CTTGAGCAGATCACCACCGTTATGGGTAAGTTATACACAAGATTTAATTAACACGGACTGAGCACTAATACGCAA
CAGGGGCTAACTGTGGTGGGACTGCTATTGACAGTCGATTCTATGAACTACTGTCCACTAGAGTTGAAGGGGGAT
TCGATTCCCTATCCCTGAGCGAGATCCGACCAGGGAGCCGCGCCATGAAAAAGTTTGAAAGGATCAAGACTCATT
TCAATAGTGCAACGAGTCAGTCTTGGCACTTTGATTTCAACTTGAATTCCCAGTCTCCCAGCCAAAGACGAGGAC
GTGTTGTTCTTCAAGCCGAAGATGTCCGAGACCTATACGAGCCTGTTCTGAGAAATATTTTCGACTTGATTCTGT
CCCAGATCACTGCTGCAAATGAGAAGTGTGGACGGCATGTCATCAAAGTGAGCGTCTCTTTTATCCTTGCTTTGT
GGGGTACTTATGAAACTAACATTATCATCTTCTATAGAAAGTTGTCTTGGTTGGCGGATTCAGCGCCTCATCCTA
TCTGCAGGAAAGCCTAGGATCTGCCCTCAATCGCATCGGCATTTCCGTGCTTATTCCTGAGAACCCGTGAGCGAA
AATATCTTTTGGATGCTACAAAGTTAGCGAGAAGTCTAACATGTATATCAAAGGGAGGAGGCTATCGCTCGTGGG
GCAGCAGTCCAAGGCCTTCGGGGCTACTCTCTTCCGACCTACAAGTGCTGGCGAAATTACGGCCTCGCATCGTTT
CAAAGTTTCTCCCACCCCAATGAACCGCAATTCCTGGGATATGGGCCTAGCGCACTATCGGTGAATTTGCTCCCC
TGTTGGGTGTTACGCAAGGTGTGTATTATCCAAGTGTCCGCAACCACCCTGTACGATCTGACAGATCGTTTCCAA
AAAAAAGGACCAGAACTACCCAAAGGGATTTCAGTCCACCCATAGCATCCAGGTACTTCATTGGGAGCATGATCT
TCTTACCAAACCCGTGGAGATTTATGAGTCCAATCTCTCAGATGCACCAGAGCGGTTTGAAAACTCCGGTAAGTC
CAATGTTTTCAACCACAAAACATATGCATATCTTTATAAGCAGTGATTGGGAATGCTGAGAGAAGTTCATTATAG
ATGCTCATTGCATCGATTATATTCAATGTCACTTCGATCACCTTGACCTTGCCTCGTTTCCTCACCGAACCATCG
CCGGACATACCGTCTATTACTTGGAGCTTTTGATCCAGGTATCTGTGTCAATGACCGATCGGGTGATACATTTCA
GTGCATTTGCAAATGGTAATGTAATAGGACAAAAGGACCTGGTCATGGCCCATGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail