Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9459.t1
Gene name
Locationscaffold_48:64814..66089
Strand+
Gene length (bp)1275
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10544 T5orf172 T5orf172 domain 8.6E-19 240 347
PF13455 MUG113 Meiotically up-regulated gene 113 4.1E-17 254 347

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9459.t1
MKLLYPTKHSTKSKVEVKRRRHLIAKVEIISQILVAKAKEAAERNHQNRQALRTKLAPELNQRKRSNQLSSSDRS
GMRDMDENFEVLSPRDVRSFSFILEPTTKKRFCRKKIELWLPKNPHEITMDFSRPGMALLRPQSLTYATSGPAKQ
SLSSKKSSTTKKSVLNAIAEPRISTTLFIGETTQSGYQGKKKQADLGLNEVNPIQKFKPYVSKTIIRNLSESLRE
LLTKPLSKSDLKFKGSIYVFWQQGNFGYLKIGRSANVRRRFKEWSDQCKKDMGIHFPDFTRETSDGERVLEEVAH
ICRVEALVHLELLEHRKIEEKCPGCSRNHIEWFQVSDEKAIAVAQKWMAWMRTEPYENRGTEGEEKWVLKAREME
RLGELSQPLFPKLAPESQVREERLASLRPRASSSTPWRDGKNKLGRRSI*
Coding >Pro_DTO377G3_2|g9459.t1
ATGAAGCTACTATATCCAACCAAGCACTCAACTAAAAGCAAGGTAGAGGTGAAAAGAAGGAGGCACCTCATTGCA
AAAGTCGAGATTATTTCGCAAATTCTCGTCGCAAAAGCGAAGGAAGCAGCCGAAAGAAACCACCAGAACCGTCAA
GCCTTGCGGACGAAACTAGCACCAGAACTCAATCAACGCAAACGGAGTAACCAGTTGTCCTCCAGCGACAGATCT
GGTATGCGTGATATGGATGAAAATTTTGAGGTTCTATCTCCACGAGATGTCAGATCCTTCTCATTCATCCTCGAA
CCAACCACGAAGAAGCGGTTTTGTCGAAAGAAGATCGAACTCTGGTTGCCGAAAAACCCACACGAGATAACGATG
GACTTCTCCCGTCCAGGAATGGCACTTCTTAGACCACAGTCTTTGACATATGCTACTTCTGGGCCCGCTAAGCAG
AGCTTATCATCTAAGAAATCCTCAACTACCAAAAAGTCTGTTTTGAACGCAATCGCGGAGCCACGCATTTCAACC
ACTCTGTTCATTGGTGAAACCACACAGTCTGGTTACCAGGGCAAGAAAAAGCAAGCGGATTTGGGTTTGAACGAG
GTCAATCCAATTCAAAAATTCAAACCTTACGTGTCAAAAACCATCATCCGAAACCTATCTGAGAGTCTTAGGGAA
CTTCTTACCAAGCCTCTCTCGAAAAGCGATTTGAAATTCAAGGGTTCGATATATGTCTTTTGGCAACAAGGCAAT
TTTGGATACCTCAAGATTGGACGCTCGGCAAATGTTCGTCGCCGTTTCAAGGAATGGTCTGATCAATGTAAGAAG
GATATGGGAATTCACTTTCCAGACTTCACGCGAGAGACAAGTGATGGCGAGCGAGTTTTGGAAGAGGTCGCCCAT
ATTTGTCGTGTCGAGGCTCTGGTTCATCTAGAACTGTTGGAGCACAGAAAAATCGAAGAGAAATGCCCAGGCTGC
TCTCGGAACCACATAGAGTGGTTTCAAGTCTCAGATGAAAAGGCAATAGCCGTTGCACAGAAGTGGATGGCTTGG
ATGAGAACGGAACCGTATGAGAATCGAGGAACGGAAGGTGAAGAAAAATGGGTGCTAAAAGCCAGAGAAATGGAG
CGACTAGGAGAGCTTAGTCAACCTTTATTTCCCAAATTGGCCCCAGAATCTCAGGTTCGGGAAGAAAGACTGGCT
TCTCTTCGTCCTAGGGCTTCCTCTTCAACCCCATGGCGAGATGGAAAGAACAAATTGGGACGGAGATCAATTTAG
Transcript >Pro_DTO377G3_2|g9459.t1
ATGAAGCTACTATATCCAACCAAGCACTCAACTAAAAGCAAGGTAGAGGTGAAAAGAAGGAGGCACCTCATTGCA
AAAGTCGAGATTATTTCGCAAATTCTCGTCGCAAAAGCGAAGGAAGCAGCCGAAAGAAACCACCAGAACCGTCAA
GCCTTGCGGACGAAACTAGCACCAGAACTCAATCAACGCAAACGGAGTAACCAGTTGTCCTCCAGCGACAGATCT
GGTATGCGTGATATGGATGAAAATTTTGAGGTTCTATCTCCACGAGATGTCAGATCCTTCTCATTCATCCTCGAA
CCAACCACGAAGAAGCGGTTTTGTCGAAAGAAGATCGAACTCTGGTTGCCGAAAAACCCACACGAGATAACGATG
GACTTCTCCCGTCCAGGAATGGCACTTCTTAGACCACAGTCTTTGACATATGCTACTTCTGGGCCCGCTAAGCAG
AGCTTATCATCTAAGAAATCCTCAACTACCAAAAAGTCTGTTTTGAACGCAATCGCGGAGCCACGCATTTCAACC
ACTCTGTTCATTGGTGAAACCACACAGTCTGGTTACCAGGGCAAGAAAAAGCAAGCGGATTTGGGTTTGAACGAG
GTCAATCCAATTCAAAAATTCAAACCTTACGTGTCAAAAACCATCATCCGAAACCTATCTGAGAGTCTTAGGGAA
CTTCTTACCAAGCCTCTCTCGAAAAGCGATTTGAAATTCAAGGGTTCGATATATGTCTTTTGGCAACAAGGCAAT
TTTGGATACCTCAAGATTGGACGCTCGGCAAATGTTCGTCGCCGTTTCAAGGAATGGTCTGATCAATGTAAGAAG
GATATGGGAATTCACTTTCCAGACTTCACGCGAGAGACAAGTGATGGCGAGCGAGTTTTGGAAGAGGTCGCCCAT
ATTTGTCGTGTCGAGGCTCTGGTTCATCTAGAACTGTTGGAGCACAGAAAAATCGAAGAGAAATGCCCAGGCTGC
TCTCGGAACCACATAGAGTGGTTTCAAGTCTCAGATGAAAAGGCAATAGCCGTTGCACAGAAGTGGATGGCTTGG
ATGAGAACGGAACCGTATGAGAATCGAGGAACGGAAGGTGAAGAAAAATGGGTGCTAAAAGCCAGAGAAATGGAG
CGACTAGGAGAGCTTAGTCAACCTTTATTTCCCAAATTGGCCCCAGAATCTCAGGTTCGGGAAGAAAGACTGGCT
TCTCTTCGTCCTAGGGCTTCCTCTTCAACCCCATGGCGAGATGGAAAGAACAAATTGGGACGGAGATCAATTTAG
Gene >Pro_DTO377G3_2|g9459.t1
ATGAAGCTACTATATCCAACCAAGCACTCAACTAAAAGCAAGGTAGAGGTGAAAAGAAGGAGGCACCTCATTGCA
AAAGTCGAGATTATTTCGCAAATTCTCGTCGCAAAAGCGAAGGAAGCAGCCGAAAGAAACCACCAGAACCGTCAA
GCCTTGCGGACGAAACTAGCACCAGAACTCAATCAACGCAAACGGAGTAACCAGTTGTCCTCCAGCGACAGATCT
GGTATGCGTGATATGGATGAAAATTTTGAGGTTCTATCTCCACGAGATGTCAGATCCTTCTCATTCATCCTCGAA
CCAACCACGAAGAAGCGGTTTTGTCGAAAGAAGATCGAACTCTGGTTGCCGAAAAACCCACACGAGATAACGATG
GACTTCTCCCGTCCAGGAATGGCACTTCTTAGACCACAGTCTTTGACATATGCTACTTCTGGGCCCGCTAAGCAG
AGCTTATCATCTAAGAAATCCTCAACTACCAAAAAGTCTGTTTTGAACGCAATCGCGGAGCCACGCATTTCAACC
ACTCTGTTCATTGGTGAAACCACACAGTCTGGTTACCAGGGCAAGAAAAAGCAAGCGGATTTGGGTTTGAACGAG
GTCAATCCAATTCAAAAATTCAAACCTTACGTGTCAAAAACCATCATCCGAAACCTATCTGAGAGTCTTAGGGAA
CTTCTTACCAAGCCTCTCTCGAAAAGCGATTTGAAATTCAAGGGTTCGATATATGTCTTTTGGCAACAAGGCAAT
TTTGGATACCTCAAGATTGGACGCTCGGCAAATGTTCGTCGCCGTTTCAAGGAATGGTCTGATCAATGTAAGAAG
GATATGGGAATTCACTTTCCAGACTTCACGCGAGAGACAAGTGATGGCGAGCGAGTTTTGGAAGAGGTCGCCCAT
ATTTGTCGTGTCGAGGCTCTGGTTCATCTAGAACTGTTGGAGCACAGAAAAATCGAAGAGAAATGCCCAGGCTGC
TCTCGGAACCACATAGAGTGGTTTCAAGTCTCAGATGAAAAGGCAATAGCCGTTGCACAGAAGTGGATGGCTTGG
ATGAGAACGGAACCGTATGAGAATCGAGGAACGGAAGGTGAAGAAAAATGGGTGCTAAAAGCCAGAGAAATGGAG
CGACTAGGAGAGCTTAGTCAACCTTTATTTCCCAAATTGGCCCCAGAATCTCAGGTTCGGGAAGAAAGACTGGCT
TCTCTTCGTCCTAGGGCTTCCTCTTCAACCCCATGGCGAGATGGAAAGAACAAATTGGGACGGAGATCAATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail