Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9454.t1
Gene name
Locationscaffold_48:44698..46692
Strand-
Gene length (bp)1994
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01384 PHO4 Phosphate transporter family 1.1E-116 24 556

GO

GO Term Description Terminal node
GO:0006817 phosphate ion transport Yes
GO:0016020 membrane Yes
GO:0005315 inorganic phosphate transmembrane transporter activity Yes
GO:0015291 secondary active transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0015698 inorganic anion transport No
GO:0006811 ion transport No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0006820 anion transport No
GO:0051234 establishment of localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 47 66 19
3 86 105 19
4 117 139 22
5 149 171 22
6 183 205 22
7 220 242 22
8 452 474 22
9 489 506 17
10 541 563 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9454.t1
MVLQQYDYIFAIGTIFAFLDAWNIGANDCANSWSTSVSSRSLKHWQAMILASIMEFAGAVGVGNSVSDTIRTKIV
KIDAFADNAPLLMLGMCCAVVASSLYLTFCTKIGLPVSTTHSILGGILGMGIALIGADDIIWWGGDINSGVVQVF
LAWVIAPILSGVAGALIFLITKYGILLRKNPALRALYTIPFYFLLTTGLLTMLIVWKGGSSRINLEGREIAGTVI
GVGVGMALISALFLCPWIYRRVIMGDWQLKPWDLIYGPLLFRRGEVPAPPDRVETVRNYYRGHKTLEELEAERST
DVEKSHNSNSEPGSPDLKAEPQVTANSDNGTQAVDPDVINICGPRPEGAWYSGPVLFWLLKKALLNGVEQDIVSA
QKSDSKLAGDLEKTHAHADHYDNEAEYMFSFLQILTACTASFTHGANDVANAVGPYATIYAIWRTGALEGAKTEV
PIWILVFGGAAISIGIWTYGYHIMRNLGNRLTLHSPSRGFAMELGAAIAVIIATRLKLPVSTTQCITGATVGVGL
CNGTWRTINWRMVAWIYMGWIITLPCAGIIAGCLTGIIVNAPRWGMSGV*
Coding >Pro_DTO377G3_2|g9454.t1
ATGGTTCTTCAGCAGTATGATTACATCTTCGCCATTGGCACGATATTCGCGTTCCTCGATGCATGGAACATCGGC
GCCAATGATTGCGCCAACTCCTGGTCGACGTCTGTTTCGTCGCGTTCGCTAAAGCACTGGCAAGCCATGATCCTC
GCATCTATCATGGAGTTTGCCGGAGCTGTCGGTGTAGGAAACAGTGTTTCTGATACTATCCGTACCAAGATCGTC
AAGATCGATGCCTTCGCCGACAACGCCCCCCTCCTCATGCTTGGAATGTGCTGCGCTGTAGTTGCCTCCTCTCTA
TATCTTACCTTCTGTACTAAGATCGGTCTTCCTGTTTCGACAACCCACTCCATTCTCGGTGGTATCCTTGGGATG
GGTATCGCGCTTATCGGTGCTGATGATATTATCTGGTGGGGAGGTGATATCAACTCCGGTGTTGTCCAGGTGTTC
CTTGCCTGGGTGATTGCACCCATCTTATCTGGTGTTGCCGGTGCGCTTATCTTTTTGATCACCAAGTATGGTATC
CTACTGCGGAAGAATCCCGCACTCAGGGCGTTATACACCATTCCATTCTACTTCCTTCTGACGACTGGCCTCCTT
ACTATGCTCATTGTCTGGAAGGGTGGCAGTAGCAGGATTAACCTCGAGGGGCGTGAGATAGCCGGAACTGTTATT
GGTGTTGGTGTTGGCATGGCTCTTATCTCGGCCCTCTTCCTTTGCCCCTGGATCTACCGCAGGGTGATTATGGGT
GACTGGCAGCTCAAGCCTTGGGACCTAATCTACGGCCCTCTTCTCTTCCGCCGTGGTGAAGTTCCTGCACCTCCC
GACCGTGTTGAGACCGTCCGTAACTACTATCGCGGCCACAAGACCCTAGAGGAACTGGAAGCTGAGCGTTCCACT
GATGTGGAAAAGAGCCACAACAGCAACAGCGAGCCTGGTTCCCCCGATCTCAAGGCAGAGCCCCAGGTCACTGCC
AACTCGGATAACGGGACGCAAGCCGTGGATCCCGATGTCATTAACATTTGTGGTCCTCGTCCCGAAGGAGCATGG
TATAGTGGTCCTGTCCTGTTCTGGCTGCTGAAGAAGGCCCTCCTAAACGGTGTCGAGCAAGACATTGTTAGCGCC
CAGAAGAGCGATAGCAAACTCGCTGGCGATCTCGAGAAGACCCATGCCCATGCTGATCACTATGATAACGAAGCG
GAGTACATGTTCTCTTTCCTCCAGATTCTGACAGCCTGTACCGCTTCTTTCACCCACGGTGCGAACGATGTCGCA
AATGCTGTCGGTCCCTATGCAACCATCTATGCTATATGGAGAACTGGTGCCCTTGAAGGCGCTAAGACCGAAGTC
CCCATCTGGATCCTTGTATTTGGTGGTGCCGCTATCTCCATTGGTATCTGGACATACGGTTATCACATCATGCGC
AACTTGGGTAACCGTCTTACCCTGCACTCTCCCTCTCGTGGGTTCGCTATGGAGCTCGGTGCTGCCATTGCTGTC
ATTATTGCCACCAGGCTGAAGCTCCCCGTCTCTACCACCCAGTGTATTACGGGCGCTACCGTCGGTGTTGGGCTT
TGCAACGGCACTTGGCGAACGATCAACTGGCGGATGGTTGCCTGGATCTACATGGGTTGGATCATCACGCTTCCC
TGCGCCGGTATCATCGCCGGTTGTTTGACCGGAATTATCGTGAACGCGCCTCGTTGGGGTATGTCCGGCGTCTGA
Transcript >Pro_DTO377G3_2|g9454.t1
ATGGTTCTTCAGCAGTATGATTACATCTTCGCCATTGGCACGATATTCGCGTTCCTCGATGCATGGAACATCGGC
GCCAATGATTGCGCCAACTCCTGGTCGACGTCTGTTTCGTCGCGTTCGCTAAAGCACTGGCAAGCCATGATCCTC
GCATCTATCATGGAGTTTGCCGGAGCTGTCGGTGTAGGAAACAGTGTTTCTGATACTATCCGTACCAAGATCGTC
AAGATCGATGCCTTCGCCGACAACGCCCCCCTCCTCATGCTTGGAATGTGCTGCGCTGTAGTTGCCTCCTCTCTA
TATCTTACCTTCTGTACTAAGATCGGTCTTCCTGTTTCGACAACCCACTCCATTCTCGGTGGTATCCTTGGGATG
GGTATCGCGCTTATCGGTGCTGATGATATTATCTGGTGGGGAGGTGATATCAACTCCGGTGTTGTCCAGGTGTTC
CTTGCCTGGGTGATTGCACCCATCTTATCTGGTGTTGCCGGTGCGCTTATCTTTTTGATCACCAAGTATGGTATC
CTACTGCGGAAGAATCCCGCACTCAGGGCGTTATACACCATTCCATTCTACTTCCTTCTGACGACTGGCCTCCTT
ACTATGCTCATTGTCTGGAAGGGTGGCAGTAGCAGGATTAACCTCGAGGGGCGTGAGATAGCCGGAACTGTTATT
GGTGTTGGTGTTGGCATGGCTCTTATCTCGGCCCTCTTCCTTTGCCCCTGGATCTACCGCAGGGTGATTATGGGT
GACTGGCAGCTCAAGCCTTGGGACCTAATCTACGGCCCTCTTCTCTTCCGCCGTGGTGAAGTTCCTGCACCTCCC
GACCGTGTTGAGACCGTCCGTAACTACTATCGCGGCCACAAGACCCTAGAGGAACTGGAAGCTGAGCGTTCCACT
GATGTGGAAAAGAGCCACAACAGCAACAGCGAGCCTGGTTCCCCCGATCTCAAGGCAGAGCCCCAGGTCACTGCC
AACTCGGATAACGGGACGCAAGCCGTGGATCCCGATGTCATTAACATTTGTGGTCCTCGTCCCGAAGGAGCATGG
TATAGTGGTCCTGTCCTGTTCTGGCTGCTGAAGAAGGCCCTCCTAAACGGTGTCGAGCAAGACATTGTTAGCGCC
CAGAAGAGCGATAGCAAACTCGCTGGCGATCTCGAGAAGACCCATGCCCATGCTGATCACTATGATAACGAAGCG
GAGTACATGTTCTCTTTCCTCCAGATTCTGACAGCCTGTACCGCTTCTTTCACCCACGGTGCGAACGATGTCGCA
AATGCTGTCGGTCCCTATGCAACCATCTATGCTATATGGAGAACTGGTGCCCTTGAAGGCGCTAAGACCGAAGTC
CCCATCTGGATCCTTGTATTTGGTGGTGCCGCTATCTCCATTGGTATCTGGACATACGGTTATCACATCATGCGC
AACTTGGGTAACCGTCTTACCCTGCACTCTCCCTCTCGTGGGTTCGCTATGGAGCTCGGTGCTGCCATTGCTGTC
ATTATTGCCACCAGGCTGAAGCTCCCCGTCTCTACCACCCAGTGTATTACGGGCGCTACCGTCGGTGTTGGGCTT
TGCAACGGCACTTGGCGAACGATCAACTGGCGGATGGTTGCCTGGATCTACATGGGTTGGATCATCACGCTTCCC
TGCGCCGGTATCATCGCCGGTTGTTTGACCGGAATTATCGTGAACGCGCCTCGTTGGGGTATGTCCGGCGTCTGA
Gene >Pro_DTO377G3_2|g9454.t1
ATGGTTCTTCAGCAGTATGATTACATCTTCGCCATTGGCACGATATTCGCGTTCCTCGATGCATGGAACATCGGC
GCCAATGATTGCGCCAACTCCTGGTCGACGTCTGTTTCGTCGCGTTCGCTAAAGCACTGGCAAGCCATGATCCTC
GCATCTATCATGGAGTTTGCCGGAGCGTAAGTTCATGACCTGCTTCCCACTTCCTGACTTTGTACTCACCTATAT
TTCCAGTGTCGGTGTAGGAAACAGTGTTTCTGATACTATCCGTACCAAGATCGTCAAGATCGATGCCTTCGCCGA
CAACGCCCCCCTCCTCATGCTTGGAATGTGCTGCGCTGTAGTTGCCTCCTCTCTATATCTTACCTTCTGTACTAA
GATCGGTCTTCCTGTTTCGACAACCCACTCCATTCTCGGTGGTATCCTTGGGATGGGTATCGCGCTTATCGGTGC
TGATGATATTATCTGGTGGGGAGGTGATATCAACTCCGGTGTTGTCCAGGTGTTCCTTGCCTGGGTGATTGCACC
CATCTTATCTGGTGTTGCCGGTGCGCTTATCTTTTTGATCACCAAGTATGGTATCCTACTGCGGAAGAATCCCGC
ACTCAGGGCGTTATACACCATTCCATTCTACTTCCTTCTGACGACTGGCCTCCTTACTAGTATGTTTCGTCAAAT
TTCTGATCTCTGTGTATCGGCTACTGATAAAACACAGTGCTCATTGTCTGGAAGGGTGGCAGTAGCAGGATTAAC
CTCGAGGGGCGTGAGATAGCCGGAACTGTTATTGGTGTTGGTGTTGGCATGGCTCTTATCTCGGCCCTCTTCCTT
TGCCCCTGGATCTACCGCAGGGTGATTATGGGTGACTGGCAGCTCAAGCCTTGGGACCTAATCTACGGCCCTCTT
CTCTTCCGCCGTGGTGAAGTTCCTGCACCTCCCGACCGTGTTGAGACCGTCCGTAACTACTATCGCGGCCACAAG
ACCCTAGAGGAACTGGAAGCTGAGCGTTCCACTGATGTGGAAAAGAGCCACAACAGCAACAGCGAGCCTGGTTCC
CCCGATCTCAAGGCAGAGCCCCAGGTCACTGCCAACTCGGATAACGGGACGCAAGCCGTGGATCCCGATGTCATT
AACATTTGTGGTCCTCGTCCCGAAGGAGCATGGTATAGTGGTCCTGTCCTGTTCTGGCTGCTGAAGAAGGCCCTC
CTAAACGGTGTCGAGCAAGACATTGTTAGCGCCCAGAAGAGCGATAGCAAACTCGCTGGCGATCTCGAGAAGACC
CATGCCCATGCTGATCACTATGATAACGAAGCGGAGTACATGTTCTCTTTCCTCCAGATTCTGACAGCCTGTACC
GCTTCTTTCACCCACGGTGCGAACGATGTCGCAAAGTTGGTTTTCCCATTTCATACCTACTATCAACTCATATAC
TAACTGTTCCCAGTGCTGTCGGTCCCTATGCAACCATCTATGCTATATGGAGAACTGGTGCCCTTGAAGGCGCTA
AGACCGAAGTCCCCATCTGGATCCTGTAAGTTTTATTCCATCAATGTAAGGACGCCCGTGTTAACTCACATTCTC
CAGTGTATTTGGTGGTGCCGCTATCTCCATTGGTATCTGGACATACGGTTATCACATCATGCGCAACTTGGGTAA
CCGTCTTACCCTGCACTCTCCCTCTCGTGGGTTCGCTATGGAGCTCGGTGCTGCCATTGCTGTCATTATTGCCAC
CAGGCTGAGTATGTCCCTTTTATCTATTCCCAAATCATCACCACGCTAACATGACACTTGCAGAGCTCCCCGTCT
CTACCACCCAGTGTATTACGGGCGCTACCGTCGGTGTTGGGCTTTGCAACGGCACTTGGCGAACGATCAACTGGC
GGATGGTTGCCTGGATCTACATGGGTTGGATCATCACGCTTCCCTGCGCCGGTATCATCGCCGGTTGTTTGACCG
GAATTATCGTGAACGCGCCTCGTTGGGGTATGTCCGGCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail