Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9449.t1
Gene name
Locationscaffold_48:34930..37393
Strand-
Gene length (bp)2463
Transcript length (bp)2343
Coding sequence length (bp)2343
Protein length (aa) 781

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 1.5E-08 340 404
PF13639 zf-RING_2 Ring finger domain 2.3E-08 377 404
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.6E-06 342 403

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.5

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 38 60 22
3 99 121 22
4 142 164 22
5 174 196 22
6 276 298 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9449.t1
MRLAAYAGASVVLAAGVFLKALHQRSNFYSACVYLSQSSANLMILTNLCLLVTGFILFWLQRLLYGRLRPIETEQ
LYERAWFAVTETCLAMTIFRGELGGWFLVMFISLLVGKVWGWIGEGRVEFLEQQPPANPRLFHTRLALSLVLTVS
FNFFMLRYCVHTVITQARPDMMVMFGFEFAILLILSTSTLLRYVIALTEISITRQQIKAKIQERRDEIRVARVEA
IREHARAGATSPPDNLPDENDVNELEIDVPGWEEKGRWVFYLDLLTDLLKLLIYLSFFGILLTFYGLPIHILRDV
VVTIRSFARRIMDFMRYRNATRDMHQRYPDATAEEISREDVCIICREEMIPVRPAQPGADAAGEPAPQRVPDRLR
PKKLPCGHILHFSCLRSWLERQQNCPTCRRPVIMPQRTQGAAGVADNNARGGQNGGIRPGQQGADAQPRARVYQF
GPFRIGFGAVRGDLFNNLHQGNAPRANPPANAPGGQIGFGFGFGRRPQAPTPAPQAAAGGSIAAEINDQLLHIEH
RLNQEIATLRAATEHLNHVRQLRGELERLLAQARAVNRPAAGQPGAGQPAPPPNIAPASSLFTTSHQYGANPGTD
VLNPGDPRLPEGLTLPPGWTLLPLQRMDNSAGGVEQTVQPTPTTTVTSPAAPAVASAVTSQVSPFPVPAQDQTSG
SVGINAHGTVNAETHPVNGAPSPPVLQPTPTVPSVEHRAESPSQEWTDVAPRGSFDARPASIPTTWGTNEESASS
ASAQAETQPESTSHGKRRTASVEETPDEEA*
Coding >Pro_DTO377G3_2|g9449.t1
ATGAGACTGGCCGCTTATGCTGGGGCCTCAGTGGTCCTAGCCGCTGGTGTGTTTCTAAAAGCTCTCCATCAGAGG
TCCAATTTCTATTCGGCATGCGTCTATCTCTCTCAGAGTAGTGCGAATCTTATGATCCTCACGAATTTATGCCTT
CTCGTCACCGGCTTTATCTTATTCTGGCTCCAGCGACTTCTCTACGGACGCTTGCGACCAATCGAGACCGAACAA
CTATACGAGCGGGCCTGGTTCGCCGTCACAGAGACATGTCTGGCTATGACCATCTTCCGAGGCGAACTTGGAGGC
TGGTTTCTGGTCATGTTCATTTCGCTGCTGGTCGGTAAGGTCTGGGGATGGATTGGCGAAGGCCGCGTTGAGTTC
CTAGAGCAACAGCCGCCGGCTAATCCCCGGTTGTTCCATACTCGACTGGCGCTATCTCTCGTGCTGACGGTGTCG
TTCAACTTCTTTATGTTACGGTACTGTGTGCACACTGTAATCACGCAGGCACGGCCGGATATGATGGTGATGTTT
GGATTCGAATTCGCCATCTTGCTAATCCTCTCGACCTCCACCCTCCTGCGATACGTTATCGCGTTAACCGAAATA
TCCATAACCCGCCAGCAAATAAAGGCCAAGATCCAGGAACGTAGGGATGAGATCCGTGTTGCGCGAGTCGAAGCA
ATTCGAGAACATGCCCGCGCGGGAGCTACCTCCCCTCCTGACAATCTGCCCGACGAAAACGATGTCAATGAGTTG
GAGATCGACGTGCCCGGGTGGGAGGAGAAGGGTCGTTGGGTCTTCTACTTGGATCTTTTGACCGATTTGTTGAAA
CTCCTGATTTATTTGAGCTTCTTTGGCATTCTGCTCACTTTCTACGGCCTCCCCATCCACATTCTGCGGGACGTT
GTTGTGACCATCCGCTCATTTGCGCGTCGAATTATGGACTTCATGCGTTACAGAAACGCGACAAGGGATATGCAT
CAGAGGTATCCGGATGCAACAGCGGAGGAAATCTCCCGGGAAGATGTCTGTATCATCTGCCGTGAAGAGATGATT
CCGGTTCGGCCGGCGCAACCGGGGGCTGATGCGGCTGGAGAGCCTGCACCACAGCGTGTTCCTGACCGTCTACGC
CCAAAGAAGCTCCCATGTGGCCATATCCTGCACTTTTCGTGTCTCCGAAGCTGGCTTGAGAGGCAACAAAATTGC
CCGACATGCCGACGTCCTGTTATAATGCCACAGCGAACTCAGGGAGCTGCCGGGGTTGCAGACAACAACGCACGC
GGAGGTCAGAATGGTGGTATTCGGCCAGGCCAACAAGGTGCGGATGCACAACCACGTGCTCGGGTCTATCAGTTT
GGACCCTTCCGCATCGGCTTTGGAGCTGTGCGTGGAGATTTATTCAACAATCTTCACCAAGGTAATGCGCCGCGG
GCAAACCCCCCTGCGAATGCCCCTGGAGGACAAATCGGGTTTGGATTTGGATTCGGGCGCCGTCCCCAAGCCCCC
ACCCCCGCCCCACAAGCTGCGGCTGGGGGATCTATCGCTGCTGAAATCAATGATCAGTTGCTGCACATCGAGCAC
CGGCTGAACCAAGAGATTGCCACCCTTCGAGCTGCTACAGAGCATCTAAATCACGTGCGCCAGCTTCGGGGGGAA
CTAGAGCGGTTGCTTGCTCAAGCAAGGGCTGTTAACCGACCAGCTGCCGGTCAACCTGGTGCCGGCCAACCGGCT
CCGCCTCCAAACATAGCCCCGGCATCTTCTTTATTCACAACGAGCCACCAGTATGGCGCAAACCCGGGCACTGAT
GTTCTAAACCCTGGAGACCCTCGTCTACCGGAAGGGCTCACTCTTCCCCCTGGTTGGACCCTCCTTCCTCTCCAG
CGTATGGATAATAGTGCCGGCGGTGTGGAACAAACAGTACAACCTACTCCTACCACTACAGTGACATCCCCGGCT
GCTCCAGCCGTGGCTAGCGCTGTAACTTCTCAGGTCTCTCCATTCCCCGTTCCTGCTCAGGATCAAACGAGCGGG
AGCGTCGGGATAAATGCGCACGGCACCGTCAATGCTGAAACCCATCCCGTAAATGGGGCCCCTAGTCCACCGGTA
CTGCAACCAACACCCACTGTCCCCTCAGTGGAACATCGTGCAGAATCCCCGTCTCAGGAATGGACCGACGTTGCT
CCTAGAGGGTCCTTTGACGCCAGGCCAGCTTCTATTCCTACTACATGGGGTACCAATGAGGAATCTGCAAGTAGT
GCTTCTGCTCAAGCCGAGACTCAACCCGAGTCCACATCCCACGGCAAGCGCCGGACCGCATCAGTTGAGGAAACT
CCTGATGAAGAAGCTTGA
Transcript >Pro_DTO377G3_2|g9449.t1
ATGAGACTGGCCGCTTATGCTGGGGCCTCAGTGGTCCTAGCCGCTGGTGTGTTTCTAAAAGCTCTCCATCAGAGG
TCCAATTTCTATTCGGCATGCGTCTATCTCTCTCAGAGTAGTGCGAATCTTATGATCCTCACGAATTTATGCCTT
CTCGTCACCGGCTTTATCTTATTCTGGCTCCAGCGACTTCTCTACGGACGCTTGCGACCAATCGAGACCGAACAA
CTATACGAGCGGGCCTGGTTCGCCGTCACAGAGACATGTCTGGCTATGACCATCTTCCGAGGCGAACTTGGAGGC
TGGTTTCTGGTCATGTTCATTTCGCTGCTGGTCGGTAAGGTCTGGGGATGGATTGGCGAAGGCCGCGTTGAGTTC
CTAGAGCAACAGCCGCCGGCTAATCCCCGGTTGTTCCATACTCGACTGGCGCTATCTCTCGTGCTGACGGTGTCG
TTCAACTTCTTTATGTTACGGTACTGTGTGCACACTGTAATCACGCAGGCACGGCCGGATATGATGGTGATGTTT
GGATTCGAATTCGCCATCTTGCTAATCCTCTCGACCTCCACCCTCCTGCGATACGTTATCGCGTTAACCGAAATA
TCCATAACCCGCCAGCAAATAAAGGCCAAGATCCAGGAACGTAGGGATGAGATCCGTGTTGCGCGAGTCGAAGCA
ATTCGAGAACATGCCCGCGCGGGAGCTACCTCCCCTCCTGACAATCTGCCCGACGAAAACGATGTCAATGAGTTG
GAGATCGACGTGCCCGGGTGGGAGGAGAAGGGTCGTTGGGTCTTCTACTTGGATCTTTTGACCGATTTGTTGAAA
CTCCTGATTTATTTGAGCTTCTTTGGCATTCTGCTCACTTTCTACGGCCTCCCCATCCACATTCTGCGGGACGTT
GTTGTGACCATCCGCTCATTTGCGCGTCGAATTATGGACTTCATGCGTTACAGAAACGCGACAAGGGATATGCAT
CAGAGGTATCCGGATGCAACAGCGGAGGAAATCTCCCGGGAAGATGTCTGTATCATCTGCCGTGAAGAGATGATT
CCGGTTCGGCCGGCGCAACCGGGGGCTGATGCGGCTGGAGAGCCTGCACCACAGCGTGTTCCTGACCGTCTACGC
CCAAAGAAGCTCCCATGTGGCCATATCCTGCACTTTTCGTGTCTCCGAAGCTGGCTTGAGAGGCAACAAAATTGC
CCGACATGCCGACGTCCTGTTATAATGCCACAGCGAACTCAGGGAGCTGCCGGGGTTGCAGACAACAACGCACGC
GGAGGTCAGAATGGTGGTATTCGGCCAGGCCAACAAGGTGCGGATGCACAACCACGTGCTCGGGTCTATCAGTTT
GGACCCTTCCGCATCGGCTTTGGAGCTGTGCGTGGAGATTTATTCAACAATCTTCACCAAGGTAATGCGCCGCGG
GCAAACCCCCCTGCGAATGCCCCTGGAGGACAAATCGGGTTTGGATTTGGATTCGGGCGCCGTCCCCAAGCCCCC
ACCCCCGCCCCACAAGCTGCGGCTGGGGGATCTATCGCTGCTGAAATCAATGATCAGTTGCTGCACATCGAGCAC
CGGCTGAACCAAGAGATTGCCACCCTTCGAGCTGCTACAGAGCATCTAAATCACGTGCGCCAGCTTCGGGGGGAA
CTAGAGCGGTTGCTTGCTCAAGCAAGGGCTGTTAACCGACCAGCTGCCGGTCAACCTGGTGCCGGCCAACCGGCT
CCGCCTCCAAACATAGCCCCGGCATCTTCTTTATTCACAACGAGCCACCAGTATGGCGCAAACCCGGGCACTGAT
GTTCTAAACCCTGGAGACCCTCGTCTACCGGAAGGGCTCACTCTTCCCCCTGGTTGGACCCTCCTTCCTCTCCAG
CGTATGGATAATAGTGCCGGCGGTGTGGAACAAACAGTACAACCTACTCCTACCACTACAGTGACATCCCCGGCT
GCTCCAGCCGTGGCTAGCGCTGTAACTTCTCAGGTCTCTCCATTCCCCGTTCCTGCTCAGGATCAAACGAGCGGG
AGCGTCGGGATAAATGCGCACGGCACCGTCAATGCTGAAACCCATCCCGTAAATGGGGCCCCTAGTCCACCGGTA
CTGCAACCAACACCCACTGTCCCCTCAGTGGAACATCGTGCAGAATCCCCGTCTCAGGAATGGACCGACGTTGCT
CCTAGAGGGTCCTTTGACGCCAGGCCAGCTTCTATTCCTACTACATGGGGTACCAATGAGGAATCTGCAAGTAGT
GCTTCTGCTCAAGCCGAGACTCAACCCGAGTCCACATCCCACGGCAAGCGCCGGACCGCATCAGTTGAGGAAACT
CCTGATGAAGAAGCTTGA
Gene >Pro_DTO377G3_2|g9449.t1
ATGAGACTGGCCGCTTATGCTGGGGTAAGTACTGCAGCTGATGGGGAAGATAACCCGCTAACATTGGAACCCGTT
CACAGGCCTCAGTGGTCCTAGCCGCTGGTGTGTTTCTAAAAGCTCTCCATCAGAGGTCCAATTTCTATTCGGCAT
GCGTCTATCTCTCTCAGAGTAGTGCGAATCTTATGGTGAGTTGTCCAGTTTGGGTTATCGCGCTTGGCCATAGTC
CCTAACCCATTACCACATCTCCAGATCCTCACGAATTTATGCCTTCTCGTCACCGGCTTTATCTTATTCTGGCTC
CAGCGACTTCTCTACGGACGCTTGCGACCAATCGAGACCGAACAACTATACGAGCGGGCCTGGTTCGCCGTCACA
GAGACATGTCTGGCTATGACCATCTTCCGAGGCGAACTTGGAGGCTGGTTTCTGGTCATGTTCATTTCGCTGCTG
GTCGGTAAGGTCTGGGGATGGATTGGCGAAGGCCGCGTTGAGTTCCTAGAGCAACAGCCGCCGGCTAATCCCCGG
TTGTTCCATACTCGACTGGCGCTATCTCTCGTGCTGACGGTGTCGTTCAACTTCTTTATGTTACGGTACTGTGTG
CACACTGTAATCACGCAGGCACGGCCGGATATGATGGTGATGTTTGGATTCGAATTCGCCATCTTGCTAATCCTC
TCGACCTCCACCCTCCTGCGATACGTTATCGCGTTAACCGAAATATCCATAACCCGCCAGCAAATAAAGGCCAAG
ATCCAGGAACGTAGGGATGAGATCCGTGTTGCGCGAGTCGAAGCAATTCGAGAACATGCCCGCGCGGGAGCTACC
TCCCCTCCTGACAATCTGCCCGACGAAAACGATGTCAATGAGTTGGAGATCGACGTGCCCGGGTGGGAGGAGAAG
GGTCGTTGGGTCTTCTACTTGGATCTTTTGACCGATTTGTTGAAACTCCTGATTTATTTGAGCTTCTTTGGCATT
CTGCTCACTTTCTACGGCCTCCCCATCCACATTCTGCGGGACGTTGTTGTGACCATCCGCTCATTTGCGCGTCGA
ATTATGGACTTCATGCGTTACAGAAACGCGACAAGGGATATGCATCAGAGGTATCCGGATGCAACAGCGGAGGAA
ATCTCCCGGGAAGATGTCTGTATCATCTGCCGTGAAGAGATGATTCCGGTTCGGCCGGCGCAACCGGGGGCTGAT
GCGGCTGGAGAGCCTGCACCACAGCGTGTTCCTGACCGTCTACGCCCAAAGAAGCTCCCATGTGGCCATATCCTG
CACTTTTCGTGTCTCCGAAGCTGGCTTGAGAGGCAACAAAATTGCCCGACATGCCGACGTCCTGTTATAATGCCA
CAGCGAACTCAGGGAGCTGCCGGGGTTGCAGACAACAACGCACGCGGAGGTCAGAATGGTGGTATTCGGCCAGGC
CAACAAGGTGCGGATGCACAACCACGTGCTCGGGTCTATCAGTTTGGACCCTTCCGCATCGGCTTTGGAGCTGTG
CGTGGAGATTTATTCAACAATCTTCACCAAGGTAATGCGCCGCGGGCAAACCCCCCTGCGAATGCCCCTGGAGGA
CAAATCGGGTTTGGATTTGGATTCGGGCGCCGTCCCCAAGCCCCCACCCCCGCCCCACAAGCTGCGGCTGGGGGA
TCTATCGCTGCTGAAATCAATGATCAGTTGCTGCACATCGAGCACCGGCTGAACCAAGAGATTGCCACCCTTCGA
GCTGCTACAGAGCATCTAAATCACGTGCGCCAGCTTCGGGGGGAACTAGAGCGGTTGCTTGCTCAAGCAAGGGCT
GTTAACCGACCAGCTGCCGGTCAACCTGGTGCCGGCCAACCGGCTCCGCCTCCAAACATAGCCCCGGCATCTTCT
TTATTCACAACGAGCCACCAGTATGGCGCAAACCCGGGCACTGATGTTCTAAACCCTGGAGACCCTCGTCTACCG
GAAGGGCTCACTCTTCCCCCTGGTTGGACCCTCCTTCCTCTCCAGCGTATGGATAATAGTGCCGGCGGTGTGGAA
CAAACAGTACAACCTACTCCTACCACTACAGTGACATCCCCGGCTGCTCCAGCCGTGGCTAGCGCTGTAACTTCT
CAGGTCTCTCCATTCCCCGTTCCTGCTCAGGATCAAACGAGCGGGAGCGTCGGGATAAATGCGCACGGCACCGTC
AATGCTGAAACCCATCCCGTAAATGGGGCCCCTAGTCCACCGGTACTGCAACCAACACCCACTGTCCCCTCAGTG
GAACATCGTGCAGAATCCCCGTCTCAGGAATGGACCGACGTTGCTCCTAGAGGGTCCTTTGACGCCAGGCCAGCT
TCTATTCCTACTACATGGGGTACCAATGAGGAATCTGCAAGTAGTGCTTCTGCTCAAGCCGAGACTCAACCCGAG
TCCACATCCCACGGCAAGCGCCGGACCGCATCAGTTGAGGAAACTCCTGATGAAGAAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail