Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9444.t1
Gene name
Locationscaffold_48:23081..24447
Strand-
Gene length (bp)1366
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 213 235 22
2 239 258 19
3 330 352 22
4 356 378 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 21.11 10.36 31.86
5d_25C Five days - 25 degrees Celsius 17.09 7.86 26.32
7d_25C Seven days - 25 degrees Celsius 18.16 8.48 27.85
10d_25C Ten days - 25 degrees Celsius 9.24 3.37 15.12
7d_15C Seven days - 15 degrees Celsius 19.96 8.96 30.96
7d_30C Seven days - 30 degrees Celsius 24.00 11.93 36.07

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.532910 no
3d_25C 7d_25C 0.681025 no
3d_25C 7d_15C 0.900976 no
3d_25C 7d_30C 0.723487 no
3d_25C 10d_25C 0.007779 yes
5d_25C 7d_25C 0.892021 no
5d_25C 7d_15C 0.694857 no
5d_25C 7d_30C 0.282046 no
5d_25C 10d_25C 0.056880 no
7d_25C 7d_15C 0.828550 no
7d_25C 7d_30C 0.394764 no
7d_25C 10d_25C 0.033923 yes
7d_15C 7d_30C 0.612062 no
7d_15C 10d_25C 0.013810 yes
7d_30C 10d_25C 0.003197 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9444.t1
MSSDLSIAMTEIISLGDMSDQGGVLGAFGAVLGYIGAEAATEIWFSSLLWPQRSFSHVTLRSIPTLALLMPMGGP
LHKAALSTFDIANARGLLKGAHEGHMLGTSFFEQTDWTYTICGTATSEPRAARNCMWARALHYMPIPAEKPGSLA
GLSPPATDAAIEKGILPPTDNGRIPLRAKVAVYHLIFTPATAEDKASQMAFVRENCGRPGWHVYLSILIAELSGI
ILFAVVYAIGRSLWCLIWLAPLLLRLLSAFFALDHESLTPVSSSTSSPSTTPTTEAEPPRDFVLQFPQSQGGDLM
LFTGLPALVQQFFRHYGHPVRNRPREILQLSIIALFAALFPLGLLASTLWMPPLVQYAWTCYQIYIVLTMHIVRY
TSFGRNTSTESKIADYLADRPAILFGEKRHGAETVKVSLIATYHARHQEGRDCLERLVSR*
Coding >Pro_DTO377G3_2|g9444.t1
ATGTCATCAGATCTGTCCATTGCCATGACAGAAATCATCTCGCTTGGCGATATGTCCGACCAAGGTGGGGTTCTT
GGCGCTTTTGGTGCGGTGCTTGGTTATATCGGAGCAGAGGCAGCCACCGAAATCTGGTTTTCGTCCTTATTATGG
CCCCAGCGATCATTCTCCCACGTCACACTTCGATCCATCCCAACCCTGGCTCTTCTGATGCCCATGGGGGGTCCT
TTGCACAAAGCCGCTCTGAGCACCTTCGATATCGCCAACGCCCGAGGTCTCTTGAAGGGCGCCCACGAAGGCCAC
ATGCTGGGCACTTCATTCTTTGAGCAAACAGACTGGACCTACACCATTTGCGGTACAGCTACTTCCGAGCCCCGC
GCAGCTCGTAACTGCATGTGGGCGCGAGCTCTTCATTACATGCCTATACCCGCCGAAAAACCTGGATCACTGGCA
GGACTATCCCCTCCAGCCACGGACGCTGCCATCGAGAAGGGTATCCTCCCGCCCACCGACAATGGCCGCATCCCC
TTACGAGCGAAAGTCGCCGTCTACCACCTCATCTTCACTCCAGCAACGGCAGAAGATAAAGCCTCGCAGATGGCT
TTTGTGCGCGAGAACTGCGGCCGACCAGGCTGGCACGTTTACCTCAGCATCTTAATCGCCGAGCTCTCCGGCATC
ATCCTCTTTGCCGTCGTCTACGCCATCGGCCGATCACTCTGGTGTCTCATTTGGCTAGCCCCGCTGCTGCTCCGC
CTCCTGAGCGCCTTTTTCGCCCTCGACCACGAGTCCCTCACCCCTGTCTCATCCTCCACCTCATCGCCATCAACC
ACGCCGACCACCGAAGCTGAACCACCTCGTGATTTCGTCCTGCAGTTCCCCCAATCTCAGGGCGGCGACCTCATG
CTGTTCACAGGTCTCCCAGCCCTCGTGCAGCAGTTCTTCCGACACTACGGCCACCCAGTCCGGAACCGACCCCGG
GAGATTCTCCAGCTGAGCATTATAGCGCTTTTCGCTGCTCTATTTCCGCTAGGATTGCTGGCCTCGACTCTCTGG
ATGCCGCCGCTGGTTCAGTACGCGTGGACCTGTTACCAGATATACATTGTCCTAACGATGCATATCGTCCGCTAC
ACGTCGTTTGGACGGAACACGAGCACGGAATCTAAGATCGCTGATTATCTGGCGGATCGGCCGGCGATTCTTTTT
GGGGAGAAGAGACATGGGGCTGAGACGGTGAAAGTTAGTCTTATTGCGACATATCACGCGCGGCATCAGGAGGGG
AGGGATTGTTTGGAGCGCTTGGTGAGCCGGTAG
Transcript >Pro_DTO377G3_2|g9444.t1
ATGTCATCAGATCTGTCCATTGCCATGACAGAAATCATCTCGCTTGGCGATATGTCCGACCAAGGTGGGGTTCTT
GGCGCTTTTGGTGCGGTGCTTGGTTATATCGGAGCAGAGGCAGCCACCGAAATCTGGTTTTCGTCCTTATTATGG
CCCCAGCGATCATTCTCCCACGTCACACTTCGATCCATCCCAACCCTGGCTCTTCTGATGCCCATGGGGGGTCCT
TTGCACAAAGCCGCTCTGAGCACCTTCGATATCGCCAACGCCCGAGGTCTCTTGAAGGGCGCCCACGAAGGCCAC
ATGCTGGGCACTTCATTCTTTGAGCAAACAGACTGGACCTACACCATTTGCGGTACAGCTACTTCCGAGCCCCGC
GCAGCTCGTAACTGCATGTGGGCGCGAGCTCTTCATTACATGCCTATACCCGCCGAAAAACCTGGATCACTGGCA
GGACTATCCCCTCCAGCCACGGACGCTGCCATCGAGAAGGGTATCCTCCCGCCCACCGACAATGGCCGCATCCCC
TTACGAGCGAAAGTCGCCGTCTACCACCTCATCTTCACTCCAGCAACGGCAGAAGATAAAGCCTCGCAGATGGCT
TTTGTGCGCGAGAACTGCGGCCGACCAGGCTGGCACGTTTACCTCAGCATCTTAATCGCCGAGCTCTCCGGCATC
ATCCTCTTTGCCGTCGTCTACGCCATCGGCCGATCACTCTGGTGTCTCATTTGGCTAGCCCCGCTGCTGCTCCGC
CTCCTGAGCGCCTTTTTCGCCCTCGACCACGAGTCCCTCACCCCTGTCTCATCCTCCACCTCATCGCCATCAACC
ACGCCGACCACCGAAGCTGAACCACCTCGTGATTTCGTCCTGCAGTTCCCCCAATCTCAGGGCGGCGACCTCATG
CTGTTCACAGGTCTCCCAGCCCTCGTGCAGCAGTTCTTCCGACACTACGGCCACCCAGTCCGGAACCGACCCCGG
GAGATTCTCCAGCTGAGCATTATAGCGCTTTTCGCTGCTCTATTTCCGCTAGGATTGCTGGCCTCGACTCTCTGG
ATGCCGCCGCTGGTTCAGTACGCGTGGACCTGTTACCAGATATACATTGTCCTAACGATGCATATCGTCCGCTAC
ACGTCGTTTGGACGGAACACGAGCACGGAATCTAAGATCGCTGATTATCTGGCGGATCGGCCGGCGATTCTTTTT
GGGGAGAAGAGACATGGGGCTGAGACGGTGAAAGTTAGTCTTATTGCGACATATCACGCGCGGCATCAGGAGGGG
AGGGATTGTTTGGAGCGCTTGGTGAGCCGGTAG
Gene >Pro_DTO377G3_2|g9444.t1
ATGTCATCAGATCTGTCCATTGCCATGACAGGTCCGGCCATCTGGACAAAAGAAGTGAGTTCTATCTGACCACAA
CCCTTTGCTACCAGAAATCATCTCGCTTGGCGATATGTCCGACCAAGGTGGGGTTCTTGGCGCTTTTGGTGCGGT
GCTTGGTTATATCGGAGCAGAGGCAGCCACCGAAATCTGGTTTTCGTCCTTATTATGGCCCCAGCGATCATTCTC
CCACGTCACACTTCGATCCATCCCAACCCTGGCTCTTCTGATGCCCATGGGGGGTCCTTTGCACAAAGCCGCTCT
GAGCACCTTCGATATCGCCAACGCCCGAGGTCTCTTGAAGGGCGCCCACGAAGGCCACATGCTGGGCACTTCATT
CTTTGAGCAAACAGACTGGACCTACACCATTTGCGGTACAGCTACTTCCGAGCCCCGCGCAGCTCGTAACTGCAT
GTGGGCGCGAGCTCTTCATTACATGCCTATACCCGCCGAAAAACCTGGATCACTGGCAGGACTATCCCCTCCAGC
CACGGACGCTGCCATCGAGAAGGGTATCCTCCCGCCCACCGACAATGGCCGCATCCCCTTACGAGCGAAAGTCGC
CGTCTACCACCTCATCTTCACTCCAGCAACGGCAGAAGATAAAGCCTCGCAGATGGCTTTTGTGCGCGAGAACTG
CGGCCGACCAGGCTGGCACGTTTACCTCAGCATCTTAATCGCCGAGCTCTCCGGCATCATCCTCTTTGCCGTCGT
CTACGCCATCGGCCGATCACTCTGGTGTCTCATTTGGCTAGCCCCGCTGCTGCTCCGCCTCCTGAGCGCCTTTTT
CGCCCTCGACCACGAGTCCCTCACCCCTGTCTCATCCTCCACCTCATCGCCATCAACCACGCCGACCACCGAAGC
TGAACCACCTCGTGATTTCGTCCTGCAGTTCCCCCAATCTCAGGGCGGCGACCTCATGCTGTTCACAGGTCTCCC
AGCCCTCGTGCAGCAGTTCTTCCGACACTACGGCCACCCAGTCCGGAACCGACCCCGGGAGATTCTCCAGCTGAG
CATTATAGCGCTTTTCGCTGCTCTATTTCCGCTAGGATTGCTGGCCTCGACTCTCTGGATGCCGCCGCTGGTTCA
GTACGCGTGGACCTGTTACCAGATATACATTGTCCTAACGATGCATATCGTCCGCTACACGTCGTTTGGACGGAA
CACGAGCACGGAATCTAAGATCGCTGATTATCTGGCGGATCGGCCGGCGATTCTTTTTGGGGAGAAGAGACATGG
GGCTGAGACGGTGAAAGTTAGTCTTATTGCGACATATCACGCGCGGCATCAGGAGGGGAGGGATTGTTTGGAGCG
CTTGGTGAGCCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail