Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9433.t1
Gene name
Locationscaffold_47:130321..131274
Strand+
Gene length (bp)953
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 3.2E-20 33 108
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 8.2E-20 37 104
PF02798 GST_N Glutathione S-transferase, N-terminal domain 1.3E-10 29 103
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 7.0E-09 158 238

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006749 glutathione metabolic process Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006518 peptide metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0003674 molecular_function No
GO:0006575 cellular modified amino acid metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 130.26 78.32 182.20
5d_25C Five days - 25 degrees Celsius 219.61 132.66 306.56
7d_25C Seven days - 25 degrees Celsius 233.77 139.63 327.91
10d_25C Ten days - 25 degrees Celsius 311.06 187.94 434.19
7d_15C Seven days - 15 degrees Celsius 194.99 114.11 275.86
7d_30C Seven days - 30 degrees Celsius 228.26 135.80 320.72

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.009770 yes
3d_25C 7d_25C 0.003197 yes
3d_25C 7d_15C 0.069111 no
3d_25C 7d_30C 0.006000 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.846223 no
5d_25C 7d_15C 0.679525 no
5d_25C 7d_30C 0.909917 no
5d_25C 10d_25C 0.110900 no
7d_25C 7d_15C 0.495495 no
7d_25C 7d_30C 0.946422 no
7d_25C 10d_25C 0.223181 no
7d_15C 7d_30C 0.568534 no
7d_15C 10d_25C 0.033923 yes
7d_30C 10d_25C 0.175176 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9433.t1
MSAHPDSNLYPEASGPAKALVDKHRAEQPLKLYAGWFCPFVQRVWLALEEKKIPYEYIEVNPYNKPDSLLTLNPR
GLVPTLSTPADPHPRPLYESTVILEYLEEAYPDHQPRFLPDDAYERARARIWIDYVTSRIIPSFHRFLQYQPADG
TGQNADVGLDQARQEFLNHLKAWTKEMHSEGPFFLGEDISLPDLVLAPWAVRLWVLDEFKSGGLGIPREGEGGAD
EGVWSRWRTWLAAVESRRSIKETTSDLAHYLPIYKRYADNTAQSELAKATRAGRGVP*
Coding >Pro_DTO377G3_2|g9433.t1
ATGTCAGCTCATCCTGACTCCAACCTATATCCCGAGGCCAGTGGCCCGGCCAAGGCGCTGGTCGATAAGCATCGC
GCTGAACAGCCATTAAAGTTATATGCGGGGTGGTTCTGTCCATTTGTGCAACGAGTCTGGCTTGCCCTCGAGGAG
AAAAAGATTCCATACGAATATATCGAGGTCAACCCATACAACAAGCCAGACTCATTACTCACACTAAATCCGCGA
GGCCTAGTTCCTACACTCTCAACACCAGCAGATCCACACCCACGGCCACTGTACGAATCCACAGTGATCTTGGAG
TATTTGGAAGAAGCTTACCCAGACCACCAACCCCGCTTCTTGCCAGATGATGCCTACGAGCGTGCCCGCGCACGC
ATCTGGATTGACTATGTGACATCTCGAATAATCCCGTCTTTCCACCGTTTCCTACAGTACCAGCCTGCAGATGGC
ACTGGGCAGAACGCAGATGTGGGGTTGGATCAGGCTCGGCAAGAGTTTTTGAATCACCTGAAAGCCTGGACCAAG
GAGATGCACAGTGAGGGACCGTTCTTCCTTGGTGAAGATATTAGTCTGCCAGATCTGGTTTTGGCTCCGTGGGCG
GTACGACTGTGGGTGCTTGATGAGTTTAAGAGTGGTGGATTAGGGATTCCGAGGGAGGGGGAAGGGGGTGCGGAT
GAGGGAGTTTGGAGCCGATGGAGGACTTGGCTGGCTGCTGTTGAGAGCAGACGGAGTATCAAGGAGACTACCAGT
GATCTTGCGCATTACCTTCCCATCTACAAGAGATATGCGGATAATACAGCTCAAAGTGAGTTGGCTAAGGCGACA
CGGGCTGGTCGGGGGGTTCCTTGA
Transcript >Pro_DTO377G3_2|g9433.t1
ATGTCAGCTCATCCTGACTCCAACCTATATCCCGAGGCCAGTGGCCCGGCCAAGGCGCTGGTCGATAAGCATCGC
GCTGAACAGCCATTAAAGTTATATGCGGGGTGGTTCTGTCCATTTGTGCAACGAGTCTGGCTTGCCCTCGAGGAG
AAAAAGATTCCATACGAATATATCGAGGTCAACCCATACAACAAGCCAGACTCATTACTCACACTAAATCCGCGA
GGCCTAGTTCCTACACTCTCAACACCAGCAGATCCACACCCACGGCCACTGTACGAATCCACAGTGATCTTGGAG
TATTTGGAAGAAGCTTACCCAGACCACCAACCCCGCTTCTTGCCAGATGATGCCTACGAGCGTGCCCGCGCACGC
ATCTGGATTGACTATGTGACATCTCGAATAATCCCGTCTTTCCACCGTTTCCTACAGTACCAGCCTGCAGATGGC
ACTGGGCAGAACGCAGATGTGGGGTTGGATCAGGCTCGGCAAGAGTTTTTGAATCACCTGAAAGCCTGGACCAAG
GAGATGCACAGTGAGGGACCGTTCTTCCTTGGTGAAGATATTAGTCTGCCAGATCTGGTTTTGGCTCCGTGGGCG
GTACGACTGTGGGTGCTTGATGAGTTTAAGAGTGGTGGATTAGGGATTCCGAGGGAGGGGGAAGGGGGTGCGGAT
GAGGGAGTTTGGAGCCGATGGAGGACTTGGCTGGCTGCTGTTGAGAGCAGACGGAGTATCAAGGAGACTACCAGT
GATCTTGCGCATTACCTTCCCATCTACAAGAGATATGCGGATAATACAGCTCAAAGTGAGTTGGCTAAGGCGACA
CGGGCTGGTCGGGGGGTTCCTTGA
Gene >Pro_DTO377G3_2|g9433.t1
ATGTCAGCTCATCCTGACTCCAACCTATATCCCGAGGCCAGTGGCCCGGCCAAGGCGCTGGTCGATAAGCATCGC
GCTGAACAGCCATTAAAGTTATATGCGGGGTGGTTCTGTCCGTATGTCTACGACCCCTCTATACTTTAACCAACC
AACTGCTTACCAGGTATACAGATTTGGTATGTCTCTAGCCACTCGTCCATAAGTAACAATATTAACAAAATAAAG
TGCAACGAGTCTGGCTTGCCCTCGAGGAGAAAAAGATTCCATACGAATATATCGAGGTCAACCCATACAACAAGC
CAGACTCATTACTCACACTAAATCCGCGAGGCCTAGTTCCTACACTCTCAACACCAGCAGATCCACACCCACGGC
CACTGTACGAATCCACAGTGATCTTGGAGTATTTGGAAGAAGCTTACCCAGACCACCAACCCCGCTTCTTGCCAG
ATGATGCCTACGAGCGTGCCCGCGCACGCATCTGGATTGACTATGTGACATCTCGAATAATCCCGTCTTTCCACC
GTTTCCTACAGTACCAGCCTGCAGATGGCACTGGGCAGAACGCAGATGTGGGGTTGGATCAGGCTCGGCAAGAGT
TTTTGAATCACCTGAAAGCCTGGACCAAGGAGATGCACAGTGAGGGACCGTTCTTCCTTGGTGAAGATATTAGTC
TGCCAGATCTGGTTTTGGCTCCGTGGGCGGTACGACTGTGGGTGCTTGATGAGTTTAAGAGTGGTGGATTAGGGA
TTCCGAGGGAGGGGGAAGGGGGTGCGGATGAGGGAGTTTGGAGCCGATGGAGGACTTGGCTGGCTGCTGTTGAGA
GCAGACGGAGTATCAAGGAGACTACCAGTGATCTTGCGCATTACCTTCCCATCTACAAGAGATATGCGGATAATA
CAGCTCAAAGTGAGTTGGCTAAGGCGACACGGGCTGGTCGGGGGGTTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail