Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9410.t1
Gene name
Locationscaffold_47:71046..72470
Strand-
Gene length (bp)1424
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.5E-43 16 409
PF00083 Sugar_tr Sugar (and other) transporter 1.8E-06 73 237

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 75 97 22
3 109 128 19
4 133 155 22
5 167 189 22
6 199 221 22
7 268 290 22
8 305 327 22
9 334 353 19
10 358 380 22
11 401 420 19
12 424 443 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 15.00 6.86 23.14
5d_25C Five days - 25 degrees Celsius 17.24 8.21 26.26
7d_25C Seven days - 25 degrees Celsius 16.43 7.72 25.13
10d_25C Ten days - 25 degrees Celsius 18.35 8.88 27.81
7d_15C Seven days - 15 degrees Celsius 16.16 7.49 24.82
7d_30C Seven days - 30 degrees Celsius 15.47 7.12 23.83

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.715125 no
3d_25C 7d_25C 0.829709 no
3d_25C 7d_15C 0.867288 no
3d_25C 7d_30C 0.949350 no
3d_25C 10d_25C 0.578627 no
5d_25C 7d_25C 0.914996 no
5d_25C 7d_15C 0.882705 no
5d_25C 7d_30C 0.790503 no
5d_25C 10d_25C 0.886277 no
7d_25C 7d_15C 0.972218 no
7d_25C 7d_30C 0.893669 no
7d_25C 10d_25C 0.782969 no
7d_15C 7d_30C 0.926124 no
7d_15C 10d_25C 0.753366 no
7d_30C 10d_25C 0.649770 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9410.t1
MAVAGAQRKGVLKVLMLSLLLDLISFTFILPLFPSLLSFYHAQDPSPDSLLNRIFHYLNAYKNSFARPIDSRYDI
VLLGGALGSLFSLLQAFAAPVIGRLSDRHGRRRTLLISMLGNLLSVALWVSATDFRTFLASRIVGGMSEANVQMV
NAIVADITDEEHRGSAMALVGACFSVAFTFGPALGVALSSINMVAENPFIVAAIVSFALIFIETVYLWACLPETH
PRLTTLQMESKSTSTENNDALGKKTEDRSSAPAKRTHTNNPALLNTLHFLFLLPFSGLEFSLPFLTTTLYAGSAT
TVSPAALNGRLLSLMGLIASLLQGTLVRRLPPLVTLRAGVVACTISFFCLARVSSPSALYAAGALLAVTTATVVT
SLNSLGSFEAQDADRGAVMGGLRGWGQAGRATGPIVFCSLFWWAGREAAYTAGGFAMCVVTVAAFSLLKSPAVHK
KTE*
Coding >Pro_DTO377G3_2|g9410.t1
ATGGCCGTCGCTGGCGCCCAACGTAAGGGGGTGCTGAAGGTGTTGATGCTCTCGCTGTTGTTAGATTTGATCTCC
TTTACATTCATTCTGCCCCTCTTCCCTTCGCTGCTATCGTTTTATCACGCGCAAGATCCATCCCCCGATTCCCTC
CTCAACCGCATCTTCCACTACCTAAACGCCTACAAAAATTCCTTTGCGCGCCCCATTGACTCGCGCTATGACATT
GTACTCCTCGGTGGAGCCCTCGGCTCTTTGTTCTCCCTCCTTCAAGCCTTTGCTGCACCCGTCATAGGCCGCCTA
TCAGACCGTCATGGCCGCCGTCGCACCCTGCTCATCTCCATGCTCGGCAACCTCTTGAGCGTCGCGCTGTGGGTG
TCAGCTACGGACTTCCGTACATTCCTCGCCAGTCGTATCGTTGGGGGGATGAGCGAGGCAAATGTGCAAATGGTC
AACGCCATAGTGGCGGATATCACAGACGAGGAGCACCGCGGCTCTGCTATGGCATTAGTCGGGGCCTGTTTCAGT
GTCGCGTTCACTTTCGGGCCGGCGCTGGGTGTGGCGCTTAGCAGTATCAATATGGTTGCCGAAAACCCGTTCATC
GTCGCTGCAATTGTGTCTTTTGCTCTGATATTTATTGAGACTGTGTATCTTTGGGCCTGTTTGCCCGAGACGCAT
CCCCGATTGACGACGCTTCAGATGGAGAGCAAAAGTACCTCCACCGAGAATAATGATGCGTTGGGTAAGAAAACT
GAAGATAGGAGCAGTGCTCCCGCTAAGCGCACCCATACAAACAATCCGGCCCTTCTCAATACCCTCCACTTCCTC
TTCCTACTCCCATTTTCCGGTCTGGAGTTCTCCCTTCCCTTCTTGACTACAACGCTCTACGCGGGATCAGCCACA
ACAGTCAGCCCTGCTGCATTGAACGGACGTCTCTTGTCCCTGATGGGCTTAATCGCCTCTCTCCTGCAGGGTACC
CTGGTGCGCCGTCTCCCGCCGCTGGTCACCCTCCGTGCCGGTGTCGTGGCCTGTACCATATCATTCTTTTGCCTT
GCTCGCGTTTCTTCACCTTCAGCTCTCTATGCCGCCGGTGCTTTGTTGGCGGTAACGACCGCTACGGTTGTTACG
TCACTCAACAGCCTGGGCAGCTTCGAGGCACAGGATGCGGATCGCGGCGCGGTCATGGGTGGTTTGCGGGGGTGG
GGACAGGCTGGCAGGGCGACTGGTCCTATTGTGTTCTGCTCTCTGTTTTGGTGGGCTGGCCGTGAGGCTGCTTAT
ACTGCTGGCGGGTTCGCCATGTGTGTCGTCACAGTTGCAGCTTTCAGCTTGCTGAAGTCGCCTGCTGTGCATAAA
AAGACTGAATAA
Transcript >Pro_DTO377G3_2|g9410.t1
ATGGCCGTCGCTGGCGCCCAACGTAAGGGGGTGCTGAAGGTGTTGATGCTCTCGCTGTTGTTAGATTTGATCTCC
TTTACATTCATTCTGCCCCTCTTCCCTTCGCTGCTATCGTTTTATCACGCGCAAGATCCATCCCCCGATTCCCTC
CTCAACCGCATCTTCCACTACCTAAACGCCTACAAAAATTCCTTTGCGCGCCCCATTGACTCGCGCTATGACATT
GTACTCCTCGGTGGAGCCCTCGGCTCTTTGTTCTCCCTCCTTCAAGCCTTTGCTGCACCCGTCATAGGCCGCCTA
TCAGACCGTCATGGCCGCCGTCGCACCCTGCTCATCTCCATGCTCGGCAACCTCTTGAGCGTCGCGCTGTGGGTG
TCAGCTACGGACTTCCGTACATTCCTCGCCAGTCGTATCGTTGGGGGGATGAGCGAGGCAAATGTGCAAATGGTC
AACGCCATAGTGGCGGATATCACAGACGAGGAGCACCGCGGCTCTGCTATGGCATTAGTCGGGGCCTGTTTCAGT
GTCGCGTTCACTTTCGGGCCGGCGCTGGGTGTGGCGCTTAGCAGTATCAATATGGTTGCCGAAAACCCGTTCATC
GTCGCTGCAATTGTGTCTTTTGCTCTGATATTTATTGAGACTGTGTATCTTTGGGCCTGTTTGCCCGAGACGCAT
CCCCGATTGACGACGCTTCAGATGGAGAGCAAAAGTACCTCCACCGAGAATAATGATGCGTTGGGTAAGAAAACT
GAAGATAGGAGCAGTGCTCCCGCTAAGCGCACCCATACAAACAATCCGGCCCTTCTCAATACCCTCCACTTCCTC
TTCCTACTCCCATTTTCCGGTCTGGAGTTCTCCCTTCCCTTCTTGACTACAACGCTCTACGCGGGATCAGCCACA
ACAGTCAGCCCTGCTGCATTGAACGGACGTCTCTTGTCCCTGATGGGCTTAATCGCCTCTCTCCTGCAGGGTACC
CTGGTGCGCCGTCTCCCGCCGCTGGTCACCCTCCGTGCCGGTGTCGTGGCCTGTACCATATCATTCTTTTGCCTT
GCTCGCGTTTCTTCACCTTCAGCTCTCTATGCCGCCGGTGCTTTGTTGGCGGTAACGACCGCTACGGTTGTTACG
TCACTCAACAGCCTGGGCAGCTTCGAGGCACAGGATGCGGATCGCGGCGCGGTCATGGGTGGTTTGCGGGGGTGG
GGACAGGCTGGCAGGGCGACTGGTCCTATTGTGTTCTGCTCTCTGTTTTGGTGGGCTGGCCGTGAGGCTGCTTAT
ACTGCTGGCGGGTTCGCCATGTGTGTCGTCACAGTTGCAGCTTTCAGCTTGCTGAAGTCGCCTGCTGTGCATAAA
AAGACTGAATAA
Gene >Pro_DTO377G3_2|g9410.t1
ATGGCCGTCGCTGGCGCCCAACGTAAGGGGGTGCTGAAGGTGTTGATGCTCTCGCTGTTGTTAGATTTGGTAAGA
TCAAGGTACCCATCTAAAGTCAACAATCACATTTATTCAATTAACAATGCCTTCAGATCTCCTTTACATTCATTC
TGCCCCTCTTCCCTTCGCTGCTATCGTTTTATCACGCGCAAGATCCATCCCCCGATTCCCTCCTCAACCGCATCT
TCCACTACCTAAACGCCTACAAAAATTCCTTTGCGCGCCCCATTGACTCGCGCTATGACATTGTACTCCTCGGTG
GAGCCCTCGGCTCTTTGTTCTCCCTCCTTCAAGCCTTTGCTGCACCCGTCATAGGCCGCCTATCAGACCGTCATG
GCCGCCGTCGCACCCTGCTCATCTCCATGCTCGGCAACCTCTTGAGCGTCGCGCTGTGGGTGTCAGCTACGGACT
TCCGTACATTCCTCGCCAGTCGTATCGTTGGGGGGATGAGCGAGGCAAATGTGCAAATGGTCAACGCCATAGTGG
CGGATATCACAGACGAGGAGCACCGCGGCTCTGCTATGGCATTAGTCGGGGCCTGTTTCAGTGTCGCGTTCACTT
TCGGGCCGGCGCTGGGTGTGGCGCTTAGCAGTATCAATATGGTTGCCGAAAACCCGTTCATCGTCGCTGCAATTG
TGTCTTTTGCTCTGATATTTATTGAGACTGTGTATCTTTGGGCCTGTTTGCCCGAGACGCATCCCCGATTGACGA
CGCTTCAGATGGAGAGCAAAAGTACCTCCACCGAGAATAATGATGCGTTGGGTAAGAAAACTGAAGATAGGAGCA
GTGCTCCCGCTAAGCGCACCCATACAAACAATCCGGCCCTTCTCAATACCCTCCACTTCCTCTTCCTACTCCCAT
TTTCCGGTCTGGAGTTCTCCCTTCCCTTCTTGACTACAACGCTCTACGCGGGATCAGCCACAACAGTCAGCCCTG
CTGCATTGAACGGACGTCTCTTGTCCCTGATGGGCTTAATCGCCTCTCTCCTGCAGGGTACCCTGGTGCGCCGTC
TCCCGCCGCTGGTCACCCTCCGTGCCGGTGTCGTGGCCTGTACCATATCATTCTTTTGCCTTGCTCGCGTTTCTT
CACCTTCAGCTCTCTATGCCGCCGGTGCTTTGTTGGCGGTAACGACCGCTACGGTTGTTACGTCACTCAACAGCC
TGGGCAGCTTCGAGGCACAGGATGCGGATCGCGGCGCGGTCATGGGTGGTTTGCGGGGGTGGGGACAGGCTGGCA
GGGCGACTGGTCCTATTGTGTTCTGCTCTCTGTTTTGGTGGGCTGGCCGTGAGGCTGCTTATACTGCTGGCGGGT
TCGCCATGTGTGTCGTCACAGTTGCAGCTTTCAGCTTGCTGAAGTCGCCTGCTGTGCATAAAAAGACTGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail