Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9408.t1
Gene name
Locationscaffold_47:66336..69232
Strand+
Gene length (bp)2896
Transcript length (bp)2520
Coding sequence length (bp)2520
Protein length (aa) 840

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12341 Mcl1_mid Minichromosome loss protein, Mcl1, middle region 6.4E-100 419 706
PF00400 WD40 WD domain, G-beta repeat 8.8E-06 225 260
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 6.5E-06 231 273

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9408.t1
MSFDPLRPRGRPAHTPGTTILAYTPDGRRIITGGSNSAIRVYTVGEDGEPKTIDEGVDAHFGIGATNRSFIMGAE
DGTVWKYDMMSGKIQNLLVRCALPVRDIAVTRDGEWVAVASDELTVKIVKVDDMTQVKYLREQSKGTKHVTFDPS
GRYATVSGTDGILYIYSMHEEEPELVRKLDGVIRRLEPDAEATSRAVWHPDGTAFASAEATRDISIYSTSEWKKE
KTFAGGHTGDVTALSWAPNGSLLASAAADGYIVLWEAKTQKILQRYEFANVLNLSWHPTKNSLSFTTSDGELFIY
DNFVPRDHESLLQKPLQAAPILLGPLGEISNNVGRTTLTERSKEAIQRAARRGSPDSLDDILGGDDQMIDFIEDD
DGAGYADEELNIYGKRPHDDLDDLGDTSNKRLYSGFEKPKAHLPLQPGSTPWAGSRRYLCLNLTGAVWTVDQETH
HTVTVEFYDREAHRDFHFTDPYMYDKACLNDNGTLFANNPSDGSPATIFYRPHETWTARADWRTELPEGEQIRAL
ALSDSYIVTVTSKHYVRVYTLFGTPFKVYRQKSQAVTCAAWRDYIMSIGNGPIGIDGHATLRYTVENVKRDEICQ
NEDTVALPEGASLQSVFFSDNGDPCIYESTGVLLVLQHWRTSGQARWVPLLDTKQMARLAGGRKEETYWPVAVAQ
DKFHCIILKGGDKNPYFPRPLLSEFDFQIPVASTLPKDSSESGDTAAEGARFEESFVRGNVLLSLFRDLISSTNA
TASQRSDLARRELELDKNLLQMLAIECREGEERGMKALELVALMTDRNGKMLEAAAKIAQRYGRGILEDKIRDLA
ERRVMGMGDDDELA*
Coding >Pro_DTO377G3_2|g9408.t1
ATGAGTTTCGACCCTCTTCGCCCGCGGGGGCGCCCAGCCCACACACCTGGCACAACGATACTGGCCTACACACCC
GACGGAAGACGAATCATTACTGGTGGCTCCAACTCGGCTATCCGTGTTTACACGGTCGGCGAAGATGGAGAGCCC
AAGACGATCGACGAAGGTGTTGACGCGCATTTCGGCATTGGTGCTACGAATCGGTCTTTTATCATGGGTGCCGAG
GACGGAACAGTCTGGAAGTACGACATGATGTCGGGCAAAATACAAAACTTGCTTGTCCGATGTGCTTTGCCAGTC
AGGGACATTGCAGTGACGAGAGATGGAGAATGGGTCGCAGTAGCAAGCGATGAGCTCACAGTCAAAATCGTGAAA
GTCGACGACATGACGCAAGTCAAGTATCTCCGGGAACAGTCTAAGGGAACGAAGCATGTCACATTCGATCCCAGT
GGCCGATATGCAACAGTATCCGGAACAGATGGAATCCTCTATATATACTCCATGCACGAAGAGGAGCCGGAGCTG
GTCCGCAAACTCGATGGAGTTATTCGACGACTGGAGCCAGATGCCGAGGCGACATCAAGAGCAGTGTGGCATCCT
GATGGTACTGCATTTGCTTCTGCGGAAGCGACCAGAGATATCTCGATCTACTCAACCTCGGAATGGAAGAAGGAG
AAAACATTTGCTGGCGGTCATACCGGCGACGTTACGGCCTTGAGCTGGGCCCCGAACGGATCTCTTCTGGCGTCT
GCAGCTGCAGATGGATATATTGTGCTCTGGGAAGCAAAGACGCAAAAGATCTTGCAGCGATACGAATTTGCAAAT
GTCTTGAACCTATCCTGGCACCCGACCAAAAACTCACTTTCATTTACAACTTCAGATGGAGAGCTTTTCATCTAT
GATAACTTTGTACCGAGGGATCACGAGTCTCTGCTGCAGAAACCGCTGCAGGCAGCTCCTATCTTACTTGGGCCT
CTGGGCGAGATCTCCAACAATGTTGGGCGAACCACACTGACGGAGCGGTCCAAAGAGGCCATCCAGCGAGCCGCG
AGAAGAGGGTCTCCAGACTCATTGGATGATATCCTTGGTGGAGATGACCAGATGATCGATTTCATCGAGGATGAT
GATGGGGCTGGCTATGCCGATGAAGAGTTAAATATTTATGGCAAGCGGCCCCACGATGATCTCGATGATCTCGGC
GACACTAGTAACAAACGCCTCTACTCTGGCTTCGAAAAGCCCAAGGCCCATCTGCCTCTTCAACCCGGTAGCACG
CCTTGGGCTGGGAGTAGGAGATATCTTTGCCTGAACTTGACAGGAGCTGTTTGGACTGTGGACCAGGAGACACAC
CACACTGTTACTGTGGAATTCTATGACCGAGAGGCTCATCGAGATTTCCACTTCACTGATCCGTATATGTACGAC
AAGGCTTGTTTGAACGACAACGGAACACTTTTTGCCAATAACCCTTCGGATGGCAGTCCGGCCACTATTTTCTAC
AGGCCACATGAGACGTGGACTGCGCGAGCGGACTGGCGAACCGAATTGCCCGAGGGAGAACAAATTCGAGCTCTG
GCACTCAGCGATTCATACATTGTCACTGTGACATCAAAGCACTATGTTCGAGTGTACACTCTCTTTGGGACACCT
TTCAAGGTGTATCGACAGAAGAGCCAAGCCGTGACTTGCGCGGCCTGGCGCGACTACATTATGAGCATCGGCAAC
GGCCCTATAGGGATTGATGGCCACGCAACCTTACGATACACGGTGGAGAATGTCAAGCGTGACGAGATTTGCCAA
AACGAAGACACTGTCGCTCTTCCAGAAGGGGCTTCGCTACAGAGTGTTTTTTTCTCTGATAATGGGGATCCTTGT
ATATACGAGTCGACTGGCGTCCTACTAGTTCTGCAACACTGGCGCACATCCGGCCAAGCCCGATGGGTACCGCTC
CTGGACACGAAGCAAATGGCACGTCTCGCGGGAGGGCGGAAAGAAGAAACATACTGGCCGGTGGCTGTCGCACAA
GACAAGTTCCACTGTATTATCCTCAAGGGTGGTGACAAGAACCCTTACTTTCCACGGCCGCTGCTCAGTGAATTC
GACTTCCAGATCCCGGTTGCCAGTACTCTTCCGAAAGATTCCAGCGAATCCGGAGACACGGCGGCTGAGGGCGCT
CGTTTCGAGGAGTCATTCGTACGTGGAAATGTGCTTTTGTCGCTCTTCCGCGATCTTATCTCATCGACCAATGCG
ACGGCAAGCCAACGCTCTGACTTGGCGCGGAGGGAGCTCGAATTGGATAAGAACTTGCTGCAGATGCTGGCCATT
GAATGCAGAGAGGGCGAGGAGCGTGGTATGAAGGCGCTGGAGCTGGTGGCCTTGATGACGGACCGCAACGGTAAG
ATGCTCGAGGCGGCTGCTAAAATTGCACAGCGTTATGGACGTGGCATTCTTGAGGACAAGATCCGCGATCTGGCT
GAACGACGTGTCATGGGAATGGGAGACGATGATGAATTGGCTTGA
Transcript >Pro_DTO377G3_2|g9408.t1
ATGAGTTTCGACCCTCTTCGCCCGCGGGGGCGCCCAGCCCACACACCTGGCACAACGATACTGGCCTACACACCC
GACGGAAGACGAATCATTACTGGTGGCTCCAACTCGGCTATCCGTGTTTACACGGTCGGCGAAGATGGAGAGCCC
AAGACGATCGACGAAGGTGTTGACGCGCATTTCGGCATTGGTGCTACGAATCGGTCTTTTATCATGGGTGCCGAG
GACGGAACAGTCTGGAAGTACGACATGATGTCGGGCAAAATACAAAACTTGCTTGTCCGATGTGCTTTGCCAGTC
AGGGACATTGCAGTGACGAGAGATGGAGAATGGGTCGCAGTAGCAAGCGATGAGCTCACAGTCAAAATCGTGAAA
GTCGACGACATGACGCAAGTCAAGTATCTCCGGGAACAGTCTAAGGGAACGAAGCATGTCACATTCGATCCCAGT
GGCCGATATGCAACAGTATCCGGAACAGATGGAATCCTCTATATATACTCCATGCACGAAGAGGAGCCGGAGCTG
GTCCGCAAACTCGATGGAGTTATTCGACGACTGGAGCCAGATGCCGAGGCGACATCAAGAGCAGTGTGGCATCCT
GATGGTACTGCATTTGCTTCTGCGGAAGCGACCAGAGATATCTCGATCTACTCAACCTCGGAATGGAAGAAGGAG
AAAACATTTGCTGGCGGTCATACCGGCGACGTTACGGCCTTGAGCTGGGCCCCGAACGGATCTCTTCTGGCGTCT
GCAGCTGCAGATGGATATATTGTGCTCTGGGAAGCAAAGACGCAAAAGATCTTGCAGCGATACGAATTTGCAAAT
GTCTTGAACCTATCCTGGCACCCGACCAAAAACTCACTTTCATTTACAACTTCAGATGGAGAGCTTTTCATCTAT
GATAACTTTGTACCGAGGGATCACGAGTCTCTGCTGCAGAAACCGCTGCAGGCAGCTCCTATCTTACTTGGGCCT
CTGGGCGAGATCTCCAACAATGTTGGGCGAACCACACTGACGGAGCGGTCCAAAGAGGCCATCCAGCGAGCCGCG
AGAAGAGGGTCTCCAGACTCATTGGATGATATCCTTGGTGGAGATGACCAGATGATCGATTTCATCGAGGATGAT
GATGGGGCTGGCTATGCCGATGAAGAGTTAAATATTTATGGCAAGCGGCCCCACGATGATCTCGATGATCTCGGC
GACACTAGTAACAAACGCCTCTACTCTGGCTTCGAAAAGCCCAAGGCCCATCTGCCTCTTCAACCCGGTAGCACG
CCTTGGGCTGGGAGTAGGAGATATCTTTGCCTGAACTTGACAGGAGCTGTTTGGACTGTGGACCAGGAGACACAC
CACACTGTTACTGTGGAATTCTATGACCGAGAGGCTCATCGAGATTTCCACTTCACTGATCCGTATATGTACGAC
AAGGCTTGTTTGAACGACAACGGAACACTTTTTGCCAATAACCCTTCGGATGGCAGTCCGGCCACTATTTTCTAC
AGGCCACATGAGACGTGGACTGCGCGAGCGGACTGGCGAACCGAATTGCCCGAGGGAGAACAAATTCGAGCTCTG
GCACTCAGCGATTCATACATTGTCACTGTGACATCAAAGCACTATGTTCGAGTGTACACTCTCTTTGGGACACCT
TTCAAGGTGTATCGACAGAAGAGCCAAGCCGTGACTTGCGCGGCCTGGCGCGACTACATTATGAGCATCGGCAAC
GGCCCTATAGGGATTGATGGCCACGCAACCTTACGATACACGGTGGAGAATGTCAAGCGTGACGAGATTTGCCAA
AACGAAGACACTGTCGCTCTTCCAGAAGGGGCTTCGCTACAGAGTGTTTTTTTCTCTGATAATGGGGATCCTTGT
ATATACGAGTCGACTGGCGTCCTACTAGTTCTGCAACACTGGCGCACATCCGGCCAAGCCCGATGGGTACCGCTC
CTGGACACGAAGCAAATGGCACGTCTCGCGGGAGGGCGGAAAGAAGAAACATACTGGCCGGTGGCTGTCGCACAA
GACAAGTTCCACTGTATTATCCTCAAGGGTGGTGACAAGAACCCTTACTTTCCACGGCCGCTGCTCAGTGAATTC
GACTTCCAGATCCCGGTTGCCAGTACTCTTCCGAAAGATTCCAGCGAATCCGGAGACACGGCGGCTGAGGGCGCT
CGTTTCGAGGAGTCATTCGTACGTGGAAATGTGCTTTTGTCGCTCTTCCGCGATCTTATCTCATCGACCAATGCG
ACGGCAAGCCAACGCTCTGACTTGGCGCGGAGGGAGCTCGAATTGGATAAGAACTTGCTGCAGATGCTGGCCATT
GAATGCAGAGAGGGCGAGGAGCGTGGTATGAAGGCGCTGGAGCTGGTGGCCTTGATGACGGACCGCAACGGTAAG
ATGCTCGAGGCGGCTGCTAAAATTGCACAGCGTTATGGACGTGGCATTCTTGAGGACAAGATCCGCGATCTGGCT
GAACGACGTGTCATGGGAATGGGAGACGATGATGAATTGGCTTGA
Gene >Pro_DTO377G3_2|g9408.t1
ATGAGTTTCGACCCTCTTCGCCCGCGGGGGCGCCCAGCCCGTGAGTCATGCTGATGACCTAGAGACTACAATAGT
TACTGACAAGGCGGCCTCCACATAGACACACCTGGCACAACGATACTGGCCTACACACCCGACGGAAGACGAATC
ATTACTGGTGGCTCCAACTCGGCTATCCGTGTTTACACGGTCGGCGAAGATGGAGAGCCCAAGACGATCGACGAA
GGTGTTGACGCGCATTTCGGCATTGGTGCTACGGTATGTTGGAATAAGACTTACGATGCATCGAAGGAAAGGTCT
GACAGGATTGCTAGAATCGGTCTTTTATCATGGGTGCCGAGGACGGAACAGTCTGGAAGTACGACATGATGTCGG
GCAAAATACAAAACTTGCTTGTCCGATGTGCTTTGCCAGTCAGGGACATTGCAGTGACGAGAGATGGAGAATGGG
TCGCAGTAGCAAGCGAGTAAGTGCTGTAGAGATTGTGCCAGACAGTGGATTGGATGCTGACACTGGTGGACTAGT
GAGCTCACAGTCAAAATCGTGAAAGTCGACGACATGACGCAAGTCAAGTATCTCCGGGAACAGTCTAAGGGAACG
AAGCATGTCACATTCGATCCCAGTGGCCGATATGCAACAGTATCCGGAACAGATGGAATCCTCTATATATACTCC
ATGCACGAAGAGGAGCCGGAGCTGGTCCGCAAACTCGATGGAGTTATTCGACGACTGGAGCCAGATGCCGAGGCG
ACATCAAGAGCAGTGTGGCATCCTGATGGTACTGCATTTGCTTCTGCGGAAGCGACCAGAGATATCTCGATCTAC
TCAACCTCGGAATGGAAGAAGGAGAAAACATTTGCTGGCGGTCATACCGGCGACGTTACGGCCTTGAGCTGGGCC
CCGAACGGATCTCTTCTGGCGTCTGCAGCTGCAGATGGATATATTGTGCTCTGGGAAGCAAAGACGCAAAAGATC
TTGCAGCGATACGAATTTGCAAATGTCTTGAACCTATCCTGGCACCCGACCAAAAACTCACTTTCATTTACAACT
TCAGATGGAGAGCTTTTCATCTATGATAACTTTGTACCGAGGGATCACGAGTCTCTGCTGCAGAAACCGCTGCAG
GCAGCTCCTATCTTACTTGGGCCTCTGGGCGAGATCTCCAACAATGTTGGGCGAACCACACTGACGGAGCGGTCC
AAAGAGGCCATCCAGCGAGCCGCGAGAAGAGGGTCTCCAGACTCATTGGATGATATCCTTGGTGGAGATGACCAG
ATGATCGATTTCATCGAGGATGATGATGGGGCTGGCTATGCCGATGAAGAGTTAAATATTTATGGCAAGCGGCCC
CACGATGATCTCGATGATCTCGGCGACACTAGTAACAAACGCCTCTACTCTGGCTTCGAAAAGCCCAAGGCCCAT
CTGCCTCTTCAACCCGGTAGCACGCCTTGGGCTGGGAGTAGGAGATATCTTTGTATGTTCTTGTTGCAACTCATT
GGGGTGCATTTGCTAACTTGGCCAGGCCTGAACTTGACAGGAGCTGTTTGGACTGTGGACCAGGAGACACACCAC
ACTGTTACTGTGGAATTCTATGACCGAGAGGCTCATCGAGATTTCCACTTCACTGATCCGTATATGTACGACAAG
GCTTGTTTGAGTGAGTTTTCCGCTTATCCTTTTGTATTGGGTTTTTGGCTGATCGGATATAGACGACAACGGAAC
ACTTTTTGCCAATAACCCTTCGGATGGCAGTCCGGCCACTATTTTCTACAGGCCACATGAGACGTGGACTGCGCG
AGCGGACTGGCGAACCGAATTGCCCGAGGGAGAACAAATTCGAGGTAAGAATTCAAAGGATTACACAATTCACCT
TACTAATGCTCGCTATCAGCTCTGGCACTCAGCGATTCATACATTGTCACTGTGACATCAAAGCACTATGTTCGA
GTGTACACTCTCTTTGGGACACCTTTCAAGGTGTATCGACAGAAGAGCCAAGCCGTGACTTGCGCGGCCTGGCGC
GACTACATTATGAGCATCGGCAACGGCCCTATAGGGATTGATGGCCACGCAACCTTACGATACACGGTGGAGAAT
GTCAAGCGTGACGAGATTTGCCAAAACGAAGACACTGTCGCTCTTCCAGAAGGGGCTTCGCTACAGAGTGTTTTT
TTCTCTGATAATGGGGTAAGCGCCATCTAAACAGAAGAGTTGGCTATGGAATTAACCATCTTCTTAGGATCCTTG
TATATACGAGTCGACTGGCGTCCTACTAGTTCTGCAACACTGGCGCACATCCGGCCAAGCCCGATGGGTACCGCT
CCTGGACACGAAGCAAATGGCACGTCTCGCGGGAGGGCGGAAAGAAGAAACATACTGGCCGGTGGCTGTCGCACA
AGACAAGTTCCACTGTATTATCCTCAAGGGTGGTGACAAGAACCCTTACTTTCCACGGCCGCTGCTCAGTGAATT
CGACTTCCAGATCCCGGTTGCCAGTACTCTTCCGAAAGATTCCAGCGAATCCGGAGACACGGCGGCTGAGGGCGC
TCGTTTCGAGGAGTCATTCGTACGTGGAAATGTGCTTTTGTCGCTCTTCCGCGATCTTATCTCATCGACCAATGC
GACGGCAAGCCAACGCTCTGACTTGGCGCGGAGGGAGCTCGAATTGGATAAGAACTTGCTGCAGATGCTGGCCAT
TGAATGCAGAGAGGGCGAGGAGCGTGGTATGAAGGCGCTGGAGCTGGTGGCCTTGATGACGGACCGCAACGGTAA
GATGCTCGAGGCGGCTGCTAAAATTGCACAGCGTTATGGACGTGGCATTCTTGAGGACAAGATCCGCGATCTGGC
TGAACGACGTGTCATGGGAATGGGAGACGATGATGAATTGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail