Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9398.t1
Gene name
Locationscaffold_47:40756..43126
Strand+
Gene length (bp)2370
Transcript length (bp)2370
Coding sequence length (bp)2370
Protein length (aa) 790

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 2.7E-139 88 762

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 90 112 22
2 191 213 22
3 260 282 22
4 297 315 18
5 336 358 22
6 408 430 22
7 473 495 22
8 500 522 22
9 664 686 22
10 706 728 22
11 741 763 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9398.t1
MFAALKRKRLEETPTEVEIEQEIMGSEGSEFSKDPKVAETAVDEENLHFKGESAAIEQEIHDNPEIAALPLPVRH
LINLTDDPSLPTITFRYFVLAIIFVVPGAFLSQMSHFRTTTAPYSIFFVQIACHYAGHFMARVLPDWRIGLPGTR
FSFSLNPAPWSIKEHVLVTLTAASGATYNLGYAPIVLAELWYGTRINPAVAIFFMLSIVWIGYSFAALARQLLLP
DPEYIWPQALMQTTLFETFRKTDNSSALARRQMKVFFFALLGMTMWQFLPEYVFPFTSSLAFLCWVAPRNPVANF
IGSGIGGMGFLNLSLDWSNVNWNGSSIMTTPYWTQVILFLAFAFNCWVLLPAAKWGSLGSFKHGLMSNNLFLSNG
TEYPTLDVLTPDYHLNVTAYEEYGPMYMGLQNVWATFFDYAKLPAAVTWILTFGYAQISGNIRRIWSSRNAEKST
KNDSIHHQYHDRLNVIQRQYKEIPWWWYGILFSVAFVILIIFFALGHLFIPIWTLFVALSSAAILVIPFAWLYAI
SNYQLETGSFNELMYGYMVHTKAGEAHQHPCGPSVYGAIAGDAWYRAQYMLQDQKIGHYMHIPPRAVFFSQIFGT
CMGVPINYAVMRWIMDTKGDYLTGKKTDPLNQWTGQSLRTSNTMGVQYAVLGPKRLFAETEMTVLPWSFLVGAVI
PPILFCFHRFFPRLRIDLWNVSIFFGGLAMFYGNISTGYTSAIIGGYIVMYWAYRRHFEVWKRYNYLIAAAFDAG
FNLNMLLVFFFFGAGKQVSMPKWWGNNATSVERCFALDS*
Coding >Pro_DTO377G3_2|g9398.t1
ATGTTCGCTGCACTGAAGCGTAAGAGACTCGAGGAAACCCCCACCGAGGTCGAAATAGAACAAGAGATTATGGGT
TCAGAAGGCTCCGAGTTCTCTAAAGACCCAAAGGTGGCAGAGACTGCGGTAGATGAAGAGAACCTCCATTTCAAG
GGAGAATCAGCCGCCATTGAACAAGAAATACACGATAATCCCGAGATTGCTGCATTGCCCTTGCCCGTGAGACAT
CTGATCAATTTGACCGACGACCCCAGCTTACCGACAATTACCTTCCGTTACTTTGTGCTCGCCATCATCTTTGTT
GTTCCTGGTGCCTTTCTGTCGCAGATGAGTCACTTCCGCACTACCACGGCACCATACTCCATCTTCTTTGTTCAA
ATCGCCTGTCACTATGCCGGGCACTTTATGGCCAGAGTCCTTCCTGACTGGAGGATCGGTCTACCTGGTACTCGC
TTTTCTTTTAGCCTGAATCCGGCCCCATGGAGCATCAAGGAGCATGTCTTGGTCACATTGACTGCAGCGTCTGGG
GCTACGTACAATCTAGGATATGCCCCCATCGTGCTCGCAGAGCTTTGGTACGGTACACGAATCAATCCGGCGGTT
GCAATCTTCTTCATGCTTTCAATTGTGTGGATTGGTTACTCCTTTGCTGCGCTTGCCCGACAACTCCTTTTGCCT
GACCCGGAATACATCTGGCCCCAAGCTTTGATGCAAACCACATTGTTCGAAACTTTTCGCAAAACAGACAACTCC
TCTGCTCTCGCACGGCGCCAGATGAAGGTCTTCTTCTTCGCGCTTCTGGGGATGACCATGTGGCAATTCCTTCCA
GAGTACGTCTTCCCATTCACCTCATCTCTGGCCTTCCTCTGCTGGGTGGCACCTCGCAATCCGGTGGCCAACTTT
ATCGGCTCAGGCATTGGTGGCATGGGCTTCCTCAATCTCTCGTTGGATTGGTCCAATGTGAATTGGAATGGATCC
TCAATCATGACGACCCCATACTGGACACAGGTCATCTTGTTCTTGGCATTTGCTTTCAATTGTTGGGTCCTACTT
CCTGCAGCGAAGTGGGGGAGTCTAGGTTCCTTCAAGCATGGACTCATGTCAAACAACCTTTTCCTAAGCAACGGT
ACAGAATACCCAACCCTGGACGTACTCACCCCAGACTATCATCTGAACGTGACCGCTTACGAGGAGTATGGGCCG
ATGTATATGGGCTTGCAAAATGTGTGGGCGACATTCTTCGACTACGCGAAACTTCCAGCAGCGGTCACTTGGATC
TTGACCTTTGGATACGCACAGATTTCCGGGAATATCCGAAGAATCTGGTCATCCCGCAATGCAGAGAAATCCACG
AAGAACGACAGCATTCATCACCAGTATCACGATCGTCTCAATGTTATCCAGAGACAATACAAAGAGATTCCATGG
TGGTGGTATGGTATTCTATTTTCGGTAGCTTTTGTGATTCTGATTATATTCTTCGCACTCGGTCATCTATTCATC
CCAATCTGGACGTTGTTTGTGGCACTTTCGAGTGCTGCCATTCTGGTCATCCCCTTTGCTTGGCTTTACGCCATT
TCCAACTACCAGCTTGAGACCGGCTCATTCAATGAACTCATGTATGGCTACATGGTCCATACAAAAGCCGGCGAG
GCCCACCAACACCCCTGTGGTCCTTCGGTCTATGGAGCTATTGCAGGTGACGCCTGGTATCGGGCACAGTATATG
CTCCAGGACCAAAAGATTGGCCACTACATGCACATTCCACCCCGCGCGGTTTTCTTCTCCCAAATTTTCGGCACT
TGTATGGGTGTTCCAATCAACTATGCCGTCATGCGTTGGATCATGGACACCAAAGGAGATTATCTGACTGGCAAA
AAAACAGATCCACTGAATCAGTGGACAGGACAGTCCCTGCGGACCTCCAACACAATGGGAGTTCAGTACGCTGTA
CTTGGTCCAAAGAGGCTTTTCGCTGAGACGGAAATGACCGTGCTTCCCTGGTCATTCCTTGTAGGGGCGGTGATT
CCTCCTATTCTCTTCTGTTTCCACCGCTTCTTCCCCCGGCTTCGAATTGACTTGTGGAACGTCAGTATCTTTTTT
GGGGGATTGGCGATGTTCTACGGTAACATTAGTACTGGTTACACATCTGCCATTATTGGTGGATATATTGTAATG
TATTGGGCTTACCGTCGCCATTTCGAGGTCTGGAAGCGATACAACTACCTGATTGCTGCTGCGTTTGATGCTGGA
TTCAACCTCAACATGTTGCTCGTCTTCTTCTTTTTCGGAGCGGGGAAGCAAGTCTCGATGCCAAAATGGTGGGGC
AATAATGCAACGTCTGTGGAAAGATGCTTTGCTCTGGACAGCTGA
Transcript >Pro_DTO377G3_2|g9398.t1
ATGTTCGCTGCACTGAAGCGTAAGAGACTCGAGGAAACCCCCACCGAGGTCGAAATAGAACAAGAGATTATGGGT
TCAGAAGGCTCCGAGTTCTCTAAAGACCCAAAGGTGGCAGAGACTGCGGTAGATGAAGAGAACCTCCATTTCAAG
GGAGAATCAGCCGCCATTGAACAAGAAATACACGATAATCCCGAGATTGCTGCATTGCCCTTGCCCGTGAGACAT
CTGATCAATTTGACCGACGACCCCAGCTTACCGACAATTACCTTCCGTTACTTTGTGCTCGCCATCATCTTTGTT
GTTCCTGGTGCCTTTCTGTCGCAGATGAGTCACTTCCGCACTACCACGGCACCATACTCCATCTTCTTTGTTCAA
ATCGCCTGTCACTATGCCGGGCACTTTATGGCCAGAGTCCTTCCTGACTGGAGGATCGGTCTACCTGGTACTCGC
TTTTCTTTTAGCCTGAATCCGGCCCCATGGAGCATCAAGGAGCATGTCTTGGTCACATTGACTGCAGCGTCTGGG
GCTACGTACAATCTAGGATATGCCCCCATCGTGCTCGCAGAGCTTTGGTACGGTACACGAATCAATCCGGCGGTT
GCAATCTTCTTCATGCTTTCAATTGTGTGGATTGGTTACTCCTTTGCTGCGCTTGCCCGACAACTCCTTTTGCCT
GACCCGGAATACATCTGGCCCCAAGCTTTGATGCAAACCACATTGTTCGAAACTTTTCGCAAAACAGACAACTCC
TCTGCTCTCGCACGGCGCCAGATGAAGGTCTTCTTCTTCGCGCTTCTGGGGATGACCATGTGGCAATTCCTTCCA
GAGTACGTCTTCCCATTCACCTCATCTCTGGCCTTCCTCTGCTGGGTGGCACCTCGCAATCCGGTGGCCAACTTT
ATCGGCTCAGGCATTGGTGGCATGGGCTTCCTCAATCTCTCGTTGGATTGGTCCAATGTGAATTGGAATGGATCC
TCAATCATGACGACCCCATACTGGACACAGGTCATCTTGTTCTTGGCATTTGCTTTCAATTGTTGGGTCCTACTT
CCTGCAGCGAAGTGGGGGAGTCTAGGTTCCTTCAAGCATGGACTCATGTCAAACAACCTTTTCCTAAGCAACGGT
ACAGAATACCCAACCCTGGACGTACTCACCCCAGACTATCATCTGAACGTGACCGCTTACGAGGAGTATGGGCCG
ATGTATATGGGCTTGCAAAATGTGTGGGCGACATTCTTCGACTACGCGAAACTTCCAGCAGCGGTCACTTGGATC
TTGACCTTTGGATACGCACAGATTTCCGGGAATATCCGAAGAATCTGGTCATCCCGCAATGCAGAGAAATCCACG
AAGAACGACAGCATTCATCACCAGTATCACGATCGTCTCAATGTTATCCAGAGACAATACAAAGAGATTCCATGG
TGGTGGTATGGTATTCTATTTTCGGTAGCTTTTGTGATTCTGATTATATTCTTCGCACTCGGTCATCTATTCATC
CCAATCTGGACGTTGTTTGTGGCACTTTCGAGTGCTGCCATTCTGGTCATCCCCTTTGCTTGGCTTTACGCCATT
TCCAACTACCAGCTTGAGACCGGCTCATTCAATGAACTCATGTATGGCTACATGGTCCATACAAAAGCCGGCGAG
GCCCACCAACACCCCTGTGGTCCTTCGGTCTATGGAGCTATTGCAGGTGACGCCTGGTATCGGGCACAGTATATG
CTCCAGGACCAAAAGATTGGCCACTACATGCACATTCCACCCCGCGCGGTTTTCTTCTCCCAAATTTTCGGCACT
TGTATGGGTGTTCCAATCAACTATGCCGTCATGCGTTGGATCATGGACACCAAAGGAGATTATCTGACTGGCAAA
AAAACAGATCCACTGAATCAGTGGACAGGACAGTCCCTGCGGACCTCCAACACAATGGGAGTTCAGTACGCTGTA
CTTGGTCCAAAGAGGCTTTTCGCTGAGACGGAAATGACCGTGCTTCCCTGGTCATTCCTTGTAGGGGCGGTGATT
CCTCCTATTCTCTTCTGTTTCCACCGCTTCTTCCCCCGGCTTCGAATTGACTTGTGGAACGTCAGTATCTTTTTT
GGGGGATTGGCGATGTTCTACGGTAACATTAGTACTGGTTACACATCTGCCATTATTGGTGGATATATTGTAATG
TATTGGGCTTACCGTCGCCATTTCGAGGTCTGGAAGCGATACAACTACCTGATTGCTGCTGCGTTTGATGCTGGA
TTCAACCTCAACATGTTGCTCGTCTTCTTCTTTTTCGGAGCGGGGAAGCAAGTCTCGATGCCAAAATGGTGGGGC
AATAATGCAACGTCTGTGGAAAGATGCTTTGCTCTGGACAGCTGA
Gene >Pro_DTO377G3_2|g9398.t1
ATGTTCGCTGCACTGAAGCGTAAGAGACTCGAGGAAACCCCCACCGAGGTCGAAATAGAACAAGAGATTATGGGT
TCAGAAGGCTCCGAGTTCTCTAAAGACCCAAAGGTGGCAGAGACTGCGGTAGATGAAGAGAACCTCCATTTCAAG
GGAGAATCAGCCGCCATTGAACAAGAAATACACGATAATCCCGAGATTGCTGCATTGCCCTTGCCCGTGAGACAT
CTGATCAATTTGACCGACGACCCCAGCTTACCGACAATTACCTTCCGTTACTTTGTGCTCGCCATCATCTTTGTT
GTTCCTGGTGCCTTTCTGTCGCAGATGAGTCACTTCCGCACTACCACGGCACCATACTCCATCTTCTTTGTTCAA
ATCGCCTGTCACTATGCCGGGCACTTTATGGCCAGAGTCCTTCCTGACTGGAGGATCGGTCTACCTGGTACTCGC
TTTTCTTTTAGCCTGAATCCGGCCCCATGGAGCATCAAGGAGCATGTCTTGGTCACATTGACTGCAGCGTCTGGG
GCTACGTACAATCTAGGATATGCCCCCATCGTGCTCGCAGAGCTTTGGTACGGTACACGAATCAATCCGGCGGTT
GCAATCTTCTTCATGCTTTCAATTGTGTGGATTGGTTACTCCTTTGCTGCGCTTGCCCGACAACTCCTTTTGCCT
GACCCGGAATACATCTGGCCCCAAGCTTTGATGCAAACCACATTGTTCGAAACTTTTCGCAAAACAGACAACTCC
TCTGCTCTCGCACGGCGCCAGATGAAGGTCTTCTTCTTCGCGCTTCTGGGGATGACCATGTGGCAATTCCTTCCA
GAGTACGTCTTCCCATTCACCTCATCTCTGGCCTTCCTCTGCTGGGTGGCACCTCGCAATCCGGTGGCCAACTTT
ATCGGCTCAGGCATTGGTGGCATGGGCTTCCTCAATCTCTCGTTGGATTGGTCCAATGTGAATTGGAATGGATCC
TCAATCATGACGACCCCATACTGGACACAGGTCATCTTGTTCTTGGCATTTGCTTTCAATTGTTGGGTCCTACTT
CCTGCAGCGAAGTGGGGGAGTCTAGGTTCCTTCAAGCATGGACTCATGTCAAACAACCTTTTCCTAAGCAACGGT
ACAGAATACCCAACCCTGGACGTACTCACCCCAGACTATCATCTGAACGTGACCGCTTACGAGGAGTATGGGCCG
ATGTATATGGGCTTGCAAAATGTGTGGGCGACATTCTTCGACTACGCGAAACTTCCAGCAGCGGTCACTTGGATC
TTGACCTTTGGATACGCACAGATTTCCGGGAATATCCGAAGAATCTGGTCATCCCGCAATGCAGAGAAATCCACG
AAGAACGACAGCATTCATCACCAGTATCACGATCGTCTCAATGTTATCCAGAGACAATACAAAGAGATTCCATGG
TGGTGGTATGGTATTCTATTTTCGGTAGCTTTTGTGATTCTGATTATATTCTTCGCACTCGGTCATCTATTCATC
CCAATCTGGACGTTGTTTGTGGCACTTTCGAGTGCTGCCATTCTGGTCATCCCCTTTGCTTGGCTTTACGCCATT
TCCAACTACCAGCTTGAGACCGGCTCATTCAATGAACTCATGTATGGCTACATGGTCCATACAAAAGCCGGCGAG
GCCCACCAACACCCCTGTGGTCCTTCGGTCTATGGAGCTATTGCAGGTGACGCCTGGTATCGGGCACAGTATATG
CTCCAGGACCAAAAGATTGGCCACTACATGCACATTCCACCCCGCGCGGTTTTCTTCTCCCAAATTTTCGGCACT
TGTATGGGTGTTCCAATCAACTATGCCGTCATGCGTTGGATCATGGACACCAAAGGAGATTATCTGACTGGCAAA
AAAACAGATCCACTGAATCAGTGGACAGGACAGTCCCTGCGGACCTCCAACACAATGGGAGTTCAGTACGCTGTA
CTTGGTCCAAAGAGGCTTTTCGCTGAGACGGAAATGACCGTGCTTCCCTGGTCATTCCTTGTAGGGGCGGTGATT
CCTCCTATTCTCTTCTGTTTCCACCGCTTCTTCCCCCGGCTTCGAATTGACTTGTGGAACGTCAGTATCTTTTTT
GGGGGATTGGCGATGTTCTACGGTAACATTAGTACTGGTTACACATCTGCCATTATTGGTGGATATATTGTAATG
TATTGGGCTTACCGTCGCCATTTCGAGGTCTGGAAGCGATACAACTACCTGATTGCTGCTGCGTTTGATGCTGGA
TTCAACCTCAACATGTTGCTCGTCTTCTTCTTTTTCGGAGCGGGGAAGCAAGTCTCGATGCCAAAATGGTGGGGC
AATAATGCAACGTCTGTGGAAAGATGCTTTGCTCTGGACAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail