Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9385.t1
Gene name
Locationscaffold_47:10383..12128
Strand-
Gene length (bp)1745
Transcript length (bp)1659
Coding sequence length (bp)1659
Protein length (aa) 553

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 1.4E-60 130 450

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 161 183 22
2 204 226 22
3 231 253 22
4 260 279 19
5 284 303 19
6 330 349 19
7 389 411 22
8 418 440 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9385.t1
MATTTVTGHGRRASIRQAELQIPTKSSVPQSTSSPIDKFPPYEDTLDAVAGSTRPTRSASVKYTPSEVWEPRKAT
FYSREYGNGSLRNPKHRPRKSISEAITTIRTRNGNMSASAHELAEVLRAPVSYRLIGLCVVWYLTSALTNTSSKS
ILNALPMPITLTMIQFAFVSFWCLLLVYLSTVIPRLRQSIPILQHGIRYPSRDVISTALPLAVFQLAGHILSSMA
TAQIPVSLVHTIKGLSPLFTVLAYRILFRIRYARATYLSLIPLTLGVMLACSTGVSTNFFGIFCAFGAAIVFVSQ
NIFSKKLFNEVDRAESDLQTPGQRKLDKLNLLCYCSGLAFFLTLPIWFVTEGYPLVSDFIHDGVISLSGKQGSLD
HGALSMEFLFNGVSHFAQNILAFVLLSMVSPVSYSVASLVKRVFVIVVAVLWFGSSTTSIQAFGIGLTFVGLYLY
DRNSHDDVADQRANTDHFRAEQSILPMNVRHPSKPWDSNGYAFPAGRVFESALNSHAAPNNSKKEDDGPGHVRPR
GASLSRAWLPGTKQESTWQVSDSQAAT*
Coding >Pro_DTO377G3_2|g9385.t1
ATGGCTACAACTACAGTAACCGGTCATGGGCGACGCGCCTCCATACGCCAGGCCGAATTGCAAATTCCAACCAAA
TCCTCCGTTCCCCAATCAACGAGCAGTCCGATAGACAAATTTCCGCCGTACGAAGACACCCTCGACGCCGTCGCG
GGGTCAACTCGGCCAACCCGAAGCGCCTCGGTGAAATATACCCCGAGCGAGGTCTGGGAACCGCGAAAAGCAACC
TTCTACTCACGAGAGTATGGGAACGGATCATTGCGAAATCCCAAACATCGCCCACGAAAGAGCATCAGCGAAGCC
ATCACGACGATCAGAACACGCAATGGCAATATGAGTGCCAGTGCTCATGAATTGGCCGAAGTACTTCGCGCCCCA
GTCTCTTACCGACTCATTGGTCTCTGTGTCGTTTGGTATCTGACCTCTGCCCTCACAAACACGTCCTCGAAATCG
ATATTGAACGCTCTTCCGATGCCGATCACATTGACGATGATTCAATTTGCATTCGTCTCCTTCTGGTGTTTGCTA
TTGGTGTATCTCTCCACAGTTATACCTCGGTTGCGACAAAGTATCCCAATCCTCCAACATGGAATTCGCTACCCA
TCTCGCGACGTGATTTCCACAGCATTGCCCCTGGCAGTATTTCAATTGGCCGGTCACATTCTGAGCTCTATGGCC
ACTGCACAAATCCCTGTATCTCTAGTCCACACTATCAAGGGCCTTTCACCTCTCTTTACGGTTCTAGCATACCGG
ATCCTGTTTCGCATTCGATACGCCCGGGCAACCTATTTATCGCTGATCCCTCTGACTCTGGGTGTAATGCTTGCA
TGCTCGACCGGAGTGTCTACAAATTTCTTCGGTATCTTCTGCGCATTTGGTGCAGCTATCGTGTTTGTCTCGCAG
AACATATTCTCGAAGAAGCTATTCAACGAGGTAGACCGTGCAGAATCAGATCTACAAACCCCGGGGCAGCGAAAG
TTGGATAAACTCAACTTGCTTTGTTATTGCTCCGGGCTGGCTTTTTTCCTCACTCTGCCTATTTGGTTTGTCACT
GAGGGTTACCCACTAGTATCTGATTTCATTCATGATGGTGTGATATCGCTATCGGGTAAGCAAGGCTCATTGGAC
CACGGTGCTCTTTCTATGGAGTTTTTGTTCAACGGAGTCTCACACTTTGCCCAAAACATCCTGGCTTTTGTGTTG
CTGTCAATGGTATCTCCTGTGTCCTATTCGGTTGCATCATTGGTCAAACGTGTGTTTGTGATTGTGGTAGCGGTT
CTGTGGTTTGGGAGCTCGACCACCTCGATTCAAGCATTTGGCATTGGCCTCACTTTCGTGGGCCTCTACCTTTAC
GATCGCAATAGCCATGATGATGTAGCTGATCAAAGGGCAAACACGGATCATTTCCGTGCCGAACAGTCCATTCTT
CCAATGAATGTGCGGCACCCAAGCAAGCCATGGGATTCCAATGGTTATGCCTTCCCCGCGGGGAGGGTTTTTGAA
AGTGCTCTCAACTCCCATGCTGCACCAAACAACTCCAAGAAGGAAGACGATGGGCCTGGGCATGTTCGACCAAGA
GGGGCCAGTCTTTCTCGTGCTTGGTTACCAGGCACCAAACAAGAATCCACTTGGCAGGTTAGTGATTCTCAAGCT
GCAACTTAG
Transcript >Pro_DTO377G3_2|g9385.t1
ATGGCTACAACTACAGTAACCGGTCATGGGCGACGCGCCTCCATACGCCAGGCCGAATTGCAAATTCCAACCAAA
TCCTCCGTTCCCCAATCAACGAGCAGTCCGATAGACAAATTTCCGCCGTACGAAGACACCCTCGACGCCGTCGCG
GGGTCAACTCGGCCAACCCGAAGCGCCTCGGTGAAATATACCCCGAGCGAGGTCTGGGAACCGCGAAAAGCAACC
TTCTACTCACGAGAGTATGGGAACGGATCATTGCGAAATCCCAAACATCGCCCACGAAAGAGCATCAGCGAAGCC
ATCACGACGATCAGAACACGCAATGGCAATATGAGTGCCAGTGCTCATGAATTGGCCGAAGTACTTCGCGCCCCA
GTCTCTTACCGACTCATTGGTCTCTGTGTCGTTTGGTATCTGACCTCTGCCCTCACAAACACGTCCTCGAAATCG
ATATTGAACGCTCTTCCGATGCCGATCACATTGACGATGATTCAATTTGCATTCGTCTCCTTCTGGTGTTTGCTA
TTGGTGTATCTCTCCACAGTTATACCTCGGTTGCGACAAAGTATCCCAATCCTCCAACATGGAATTCGCTACCCA
TCTCGCGACGTGATTTCCACAGCATTGCCCCTGGCAGTATTTCAATTGGCCGGTCACATTCTGAGCTCTATGGCC
ACTGCACAAATCCCTGTATCTCTAGTCCACACTATCAAGGGCCTTTCACCTCTCTTTACGGTTCTAGCATACCGG
ATCCTGTTTCGCATTCGATACGCCCGGGCAACCTATTTATCGCTGATCCCTCTGACTCTGGGTGTAATGCTTGCA
TGCTCGACCGGAGTGTCTACAAATTTCTTCGGTATCTTCTGCGCATTTGGTGCAGCTATCGTGTTTGTCTCGCAG
AACATATTCTCGAAGAAGCTATTCAACGAGGTAGACCGTGCAGAATCAGATCTACAAACCCCGGGGCAGCGAAAG
TTGGATAAACTCAACTTGCTTTGTTATTGCTCCGGGCTGGCTTTTTTCCTCACTCTGCCTATTTGGTTTGTCACT
GAGGGTTACCCACTAGTATCTGATTTCATTCATGATGGTGTGATATCGCTATCGGGTAAGCAAGGCTCATTGGAC
CACGGTGCTCTTTCTATGGAGTTTTTGTTCAACGGAGTCTCACACTTTGCCCAAAACATCCTGGCTTTTGTGTTG
CTGTCAATGGTATCTCCTGTGTCCTATTCGGTTGCATCATTGGTCAAACGTGTGTTTGTGATTGTGGTAGCGGTT
CTGTGGTTTGGGAGCTCGACCACCTCGATTCAAGCATTTGGCATTGGCCTCACTTTCGTGGGCCTCTACCTTTAC
GATCGCAATAGCCATGATGATGTAGCTGATCAAAGGGCAAACACGGATCATTTCCGTGCCGAACAGTCCATTCTT
CCAATGAATGTGCGGCACCCAAGCAAGCCATGGGATTCCAATGGTTATGCCTTCCCCGCGGGGAGGGTTTTTGAA
AGTGCTCTCAACTCCCATGCTGCACCAAACAACTCCAAGAAGGAAGACGATGGGCCTGGGCATGTTCGACCAAGA
GGGGCCAGTCTTTCTCGTGCTTGGTTACCAGGCACCAAACAAGAATCCACTTGGCAGGTTAGTGATTCTCAAGCT
GCAACTTAG
Gene >Pro_DTO377G3_2|g9385.t1
ATGGCTACAACTACAGTAACCGGTCATGGGCGACGCGCCTCCATACGCCAGGCCGAATTGCAAATTCCAACCAAA
TCCTCCGTTCCCCAATCAACGAGCAGTCCGATAGACAAATTTCCGCCGTACGAAGACACCCTCGACGCCGTCGCG
GGGTCAACTCGGCCAACCCGAAGCGCCTCGGTGAAATATACCCCGAGCGAGGTCTGGGAACCGCGAAAAGCAACC
TTCTACTCACGAGAGTATGGGAACGGATCATTGCGAAATCCCAAACATCGCCCACGAAAGAGCATCAGCGAAGCC
ATCACGACGATCAGAACACGCAATGGCAATATGAGTGCCAGTGCTCATGAATTGGCCGAAGTACTTCGCGCCCCA
GTCTCTTACCGACTCATTGTATGTTGATTCGCGTTTCGAAATGAGAAATTTGCAAAGGAAAACCTCCTTCAATTA
GGCCGCTCGCTAACACACTGTCTCTCAAGGGTCTCTGTGTCGTTTGGTATCTGACCTCTGCCCTCACAAACACGT
CCTCGAAATCGATATTGAACGCTCTTCCGATGCCGATCACATTGACGATGATTCAATTTGCATTCGTCTCCTTCT
GGTGTTTGCTATTGGTGTATCTCTCCACAGTTATACCTCGGTTGCGACAAAGTATCCCAATCCTCCAACATGGAA
TTCGCTACCCATCTCGCGACGTGATTTCCACAGCATTGCCCCTGGCAGTATTTCAATTGGCCGGTCACATTCTGA
GCTCTATGGCCACTGCACAAATCCCTGTATCTCTAGTCCACACTATCAAGGGCCTTTCACCTCTCTTTACGGTTC
TAGCATACCGGATCCTGTTTCGCATTCGATACGCCCGGGCAACCTATTTATCGCTGATCCCTCTGACTCTGGGTG
TAATGCTTGCATGCTCGACCGGAGTGTCTACAAATTTCTTCGGTATCTTCTGCGCATTTGGTGCAGCTATCGTGT
TTGTCTCGCAGAACATATTCTCGAAGAAGCTATTCAACGAGGTAGACCGTGCAGAATCAGATCTACAAACCCCGG
GGCAGCGAAAGTTGGATAAACTCAACTTGCTTTGTTATTGCTCCGGGCTGGCTTTTTTCCTCACTCTGCCTATTT
GGTTTGTCACTGAGGGTTACCCACTAGTATCTGATTTCATTCATGATGGTGTGATATCGCTATCGGGTAAGCAAG
GCTCATTGGACCACGGTGCTCTTTCTATGGAGTTTTTGTTCAACGGAGTCTCACACTTTGCCCAAAACATCCTGG
CTTTTGTGTTGCTGTCAATGGTATCTCCTGTGTCCTATTCGGTTGCATCATTGGTCAAACGTGTGTTTGTGATTG
TGGTAGCGGTTCTGTGGTTTGGGAGCTCGACCACCTCGATTCAAGCATTTGGCATTGGCCTCACTTTCGTGGGCC
TCTACCTTTACGATCGCAATAGCCATGATGATGTAGCTGATCAAAGGGCAAACACGGATCATTTCCGTGCCGAAC
AGTCCATTCTTCCAATGAATGTGCGGCACCCAAGCAAGCCATGGGATTCCAATGGTTATGCCTTCCCCGCGGGGA
GGGTTTTTGAAAGTGCTCTCAACTCCCATGCTGCACCAAACAACTCCAAGAAGGAAGACGATGGGCCTGGGCATG
TTCGACCAAGAGGGGCCAGTCTTTCTCGTGCTTGGTTACCAGGCACCAAACAAGAATCCACTTGGCAGGTTAGTG
ATTCTCAAGCTGCAACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail