Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9378.t1
Gene name
Locationscaffold_46:84381..89868
Strand-
Gene length (bp)5487
Transcript length (bp)5487
Coding sequence length (bp)5487
Protein length (aa) 1829

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12257 IML1 Vacuolar membrane-associated protein Iml1 1.1E-112 195 498
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 1.2E-27 1328 1397

GO

GO Term Description Terminal node
GO:0035556 intracellular signal transduction Yes
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0007165 signal transduction No
GO:0065007 biological regulation No
GO:0050789 regulation of biological process No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9378.t1
MSLRGPMRRSHLRQVSAASLESSSTHSLEASNRDHDHDQAIDDRTVRLSSASWTRHQCALWVHDETFSREEILLN
PSAFGETEVQVGDLVEILPIRGSGDNGYSTLKPEAASKAAREGHAELNSAAQTDSTSKFKTPLQSRCLFVVKALP
PETKARNPQLEISVTNNIANIFGFKNRTQVTLAIVDRDQCAASHVDIAFRDQYMVRSDMWRLVMSELSDKIMYKG
QKIMFMGSIKATVKNIFIREKKCLSGYFSPHTIPIFRSESAKYVLFIQMSKEMWDFDSEGTGDILFSRVINGFLP
ELFKRWANSDAKHLVTIVLFTRVEYDKPNTPGQPKLSAGNLNSKFGPNKVPTRDFYRVVVNDMASGHWTTILDEL
KREFRTFLRDVSILKPDDVDPVSGIKNSKPNMATIAGHPSSALRGNILEAIHLASAHLAFDHIDRDMVHTGTSII
VITPGSGVFEVSYESLASTTEALANRGIAIDLVCLSPMPLHSVPLFKYREPVEQPSGDSGGARSSEVNRDRMSSE
IHHSLSSVVSRTSYLSPSSYLSATRMRERATPQAKEWSFGIPHWLDISYWNPETYRESRRILKKDPNAPISLTVT
RPSKAFTPRVRMYEIQMMGVMESEQANITIPYLTEGRGGTRPRGSWPGYNSGSRAPPKTRFTNPSSFKGQGQLSD
SLRRGSFVQNVADQNESQTRDTRSSRKAVMSWMDQYDETLFSVSPNPHQGTKAPKAKRPSEAEVQAAGGGVHERL
SARSITRLRHHETNPADENDSLHSGPRRIESNMTTPKSPGSVKSMSPIKPVLKKTPVPMASRISRTISFALRGLS
ATPPRALASTVVNVEHASAMPMTNQRTPAGSISDTRSITSLSPSETASTTSVFEVFPTPSTPAKSSQTPAKPISI
KMPPKNPPKESERPEDAGPHGSLSMDTPANEVGRGHGDPPNDHNIEITLSHSPRELHARSSPSKALAPWVRSVNP
CNTPKDVLRDISWFGRWQHAYPRPPHVAVVKWKSLKSPAVLPLTTEEFPTASVLASDYLQTPYRVFPNEDSEGIE
APKTRGVLLREMISLRLSHGFQLIVGKHVAEVSAQPTLESLNVFDFRGLERDGLTVFLSKGNAIHRLVCLQGGEV
EVTRFTHQNSAVIISPKKPTFTLYQPAMKTILSAEYEVKDIKLDPTSEEYNWNYADNYVAGHRDYLQNPAQQLQF
WRVRYVLIPLQLHANSRRNLQTSHEDNEEEIHLLGISQLTHIWQRFKYVSPEEKLFETSNPKRDQNPLNIMYQTR
NPSEIVTAELDRLLLTDPGLDNAPAQLLPESELLDRSSINLMSLAQIIQGEKGVRMMDRRWHWRLHYNCFIGFEF
TTWLLQNIRDIDTREQAVKFGNELIDHGLFQHVEKRHNFRDGNYFYQVCADYRVTRPESRGSWFPQLRTDKSMPS
TPAIGTVKDSPASLKARSDSIDERIPQTPSTPTKAKNKVAIMLSKSMKFDVDPRKRSNRPEVIDLHWDRLHNPEN
CFHIELSWMSTTPKLIEDTVLSWASTADKFGLKLVQVPIAEACAIDKTQPFRKPYKVTLKIPPPKGPLHTVFNNA
SFAQPGPPDRLYYQKAILRKFDFVLDFEASSAFPADVEVSYSWGKPDYKYPQFIHRTGSILAQITDEGEFLVLAN
RLVSTRSTASRDAARFENHNRSDFRGRDGLDRISPRLSPITRPVHDIGSIGSPLTPAGSASLDAGNLYRAPEHIL
NGLSEFCNDAAQLEQFYSESHARPLSTKVESTTANLMDASIPSLELPASVVSHHIPLPPGLPSRITRDSRDGLIS
PEITLARARAESISYNPSPRSGSLRPLI*
Coding >Pro_DTO377G3_2|g9378.t1
ATGTCTTTGCGCGGGCCCATGCGGCGGTCGCACCTGAGGCAAGTGAGCGCGGCGAGCTTGGAAAGCAGCTCCACC
CACTCACTGGAGGCTTCGAACCGTGACCATGACCACGACCAAGCCATAGATGATCGGACTGTCAGGCTTTCATCG
GCAAGCTGGACGCGACACCAATGTGCGCTTTGGGTGCACGATGAGACGTTTTCGCGTGAAGAGATTTTGTTGAAT
CCATCGGCTTTCGGCGAAACTGAAGTGCAAGTTGGCGATCTCGTCGAGATCCTACCCATACGGGGCTCTGGCGAT
AATGGTTATTCTACACTTAAGCCAGAGGCAGCTTCGAAAGCTGCTCGTGAGGGTCATGCCGAACTCAACTCGGCG
GCTCAAACGGACAGCACCTCGAAGTTCAAGACTCCACTGCAGAGCCGTTGTTTATTCGTCGTGAAGGCCTTACCG
CCAGAAACCAAGGCTCGGAATCCTCAATTGGAGATCTCAGTGACCAACAATATTGCCAACATCTTTGGTTTCAAG
AATAGAACTCAAGTTACATTGGCGATTGTGGATCGAGACCAATGTGCAGCGTCTCATGTCGATATTGCCTTTCGC
GATCAATACATGGTCCGATCGGACATGTGGAGACTAGTCATGTCGGAGTTATCAGATAAAATCATGTATAAAGGA
CAAAAGATCATGTTTATGGGAAGCATCAAAGCCACTGTCAAGAACATCTTTATCCGAGAGAAGAAATGCCTTTCG
GGATATTTTTCGCCACATACAATCCCTATTTTCCGAAGCGAGTCCGCCAAATATGTCCTATTCATCCAAATGTCG
AAAGAAATGTGGGACTTTGACTCGGAGGGCACTGGGGACATCCTCTTCAGTCGGGTTATCAATGGTTTCCTACCG
GAGCTCTTCAAGCGATGGGCTAATTCGGACGCCAAACATTTGGTAACTATTGTGCTATTCACTCGAGTCGAATAT
GATAAACCCAACACTCCAGGTCAGCCTAAACTCAGCGCTGGAAACTTGAACAGCAAATTTGGACCAAACAAAGTT
CCAACTCGAGATTTCTACCGTGTGGTAGTAAATGATATGGCAAGCGGCCATTGGACGACCATCCTAGACGAGCTG
AAAAGGGAATTCAGGACCTTCTTACGAGATGTGTCAATTCTAAAACCGGACGACGTTGATCCTGTATCTGGTATC
AAGAACTCCAAGCCAAACATGGCGACCATTGCCGGACACCCAAGTTCAGCTCTACGAGGAAATATTTTAGAGGCC
ATTCATCTCGCTTCTGCTCATCTGGCTTTTGATCATATCGATCGCGACATGGTCCATACTGGCACCTCGATCATT
GTTATCACACCCGGTAGTGGCGTTTTTGAGGTCTCCTACGAGTCCTTGGCTTCTACAACAGAAGCCCTTGCGAAC
CGAGGCATAGCAATTGACTTAGTCTGTTTGAGTCCGATGCCTCTCCATTCTGTGCCACTTTTCAAATACCGGGAG
CCAGTGGAGCAACCTTCTGGGGATTCAGGGGGAGCTAGATCCAGTGAAGTGAACAGGGATAGGATGTCTTCTGAG
ATACACCATTCCCTTTCAAGCGTTGTCAGCAGAACGTCATATCTTTCTCCAAGTTCATACCTGTCTGCAACTAGA
ATGAGGGAGCGGGCAACACCTCAAGCCAAGGAATGGAGCTTTGGCATCCCTCATTGGCTTGATATCTCCTATTGG
AACCCTGAAACGTACCGAGAGTCCCGGCGAATCTTGAAAAAAGACCCAAATGCGCCAATCTCTCTTACCGTCACT
CGTCCATCAAAGGCATTCACGCCACGAGTGCGTATGTATGAGATCCAAATGATGGGAGTTATGGAAAGCGAACAA
GCAAACATCACAATCCCCTACCTTACTGAAGGGCGCGGTGGAACAAGACCTCGTGGATCTTGGCCCGGCTACAAT
TCAGGTAGTCGCGCTCCCCCTAAAACACGTTTCACGAACCCTTCATCTTTCAAGGGACAAGGACAACTTAGTGAT
AGCCTTCGCCGGGGGTCCTTTGTTCAAAACGTGGCAGACCAAAATGAATCGCAGACTCGAGATACGCGGAGTTCA
CGAAAGGCAGTGATGTCTTGGATGGATCAATACGATGAAACCCTTTTCTCTGTCTCTCCAAATCCGCACCAGGGT
ACTAAAGCGCCCAAGGCAAAGCGACCCAGTGAAGCGGAAGTCCAGGCTGCTGGGGGTGGAGTGCATGAACGGTTA
TCTGCCCGTTCTATCACCCGCCTTCGCCATCATGAAACGAATCCAGCAGACGAGAATGATTCTTTGCACTCTGGT
CCTCGAAGAATTGAGTCGAATATGACTACACCAAAAAGCCCAGGATCGGTCAAGAGTATGTCTCCCATAAAACCA
GTGTTGAAAAAGACGCCGGTGCCAATGGCATCACGTATTTCTCGGACAATTAGCTTCGCACTTCGAGGCTTGAGC
GCTACTCCTCCGAGGGCCTTGGCAAGCACAGTGGTAAATGTAGAACATGCCAGTGCTATGCCGATGACAAACCAA
AGAACTCCTGCCGGATCAATTTCCGATACCAGGAGCATCACTTCTTTGAGTCCGTCAGAAACTGCATCGACTACA
TCGGTCTTTGAGGTATTTCCGACGCCTTCAACACCCGCCAAGTCGTCCCAAACTCCCGCTAAGCCGATTTCCATC
AAAATGCCTCCCAAAAATCCACCAAAGGAATCCGAACGGCCAGAGGATGCGGGCCCCCATGGATCGCTGTCGATG
GACACGCCAGCGAATGAAGTCGGTCGGGGCCATGGCGATCCTCCGAACGATCACAATATCGAGATCACTCTCAGC
CATAGTCCGCGCGAGCTACATGCGCGGAGCTCCCCGAGCAAAGCTTTAGCCCCGTGGGTCCGATCGGTCAACCCA
TGCAATACCCCTAAAGATGTGCTGCGAGATATTAGTTGGTTTGGTCGTTGGCAACATGCGTATCCTCGGCCCCCA
CATGTGGCTGTGGTGAAGTGGAAGAGTTTGAAGTCTCCTGCGGTGCTTCCATTGACAACTGAAGAATTTCCGACA
GCTAGCGTGCTTGCTTCAGACTATCTACAGACACCATATCGTGTCTTCCCAAATGAAGATTCCGAAGGCATTGAA
GCACCAAAGACACGCGGGGTACTTTTACGAGAAATGATCTCGCTGCGGCTTTCTCATGGCTTCCAACTCATTGTT
GGAAAACATGTGGCTGAAGTTTCTGCGCAGCCCACCCTTGAATCATTAAACGTCTTCGATTTCCGAGGTCTAGAG
CGCGATGGGCTCACAGTGTTTCTCTCCAAAGGCAACGCGATTCACCGACTTGTCTGCCTCCAAGGGGGAGAAGTT
GAAGTGACCCGCTTTACGCATCAAAACTCTGCGGTGATCATTTCTCCCAAAAAGCCTACCTTTACTCTTTATCAA
CCGGCGATGAAAACAATATTAAGCGCGGAATACGAAGTGAAGGACATCAAGCTGGATCCAACCTCCGAAGAGTAC
AACTGGAACTATGCCGATAATTATGTGGCTGGTCATCGAGATTATCTCCAAAATCCAGCGCAGCAGCTGCAATTC
TGGCGAGTCCGTTACGTCTTGATTCCGCTTCAACTCCATGCCAATTCTCGGCGGAATTTGCAAACTTCTCATGAG
GATAACGAAGAAGAAATTCATTTGCTGGGTATCAGCCAACTGACCCATATTTGGCAACGATTCAAATACGTGTCG
CCGGAGGAAAAGCTTTTCGAGACGTCAAATCCCAAGCGAGACCAGAATCCCTTGAATATCATGTACCAAACACGC
AATCCATCGGAAATCGTTACGGCAGAGCTGGATCGTTTGCTACTCACTGATCCAGGGCTCGACAATGCCCCGGCT
CAGCTCTTGCCGGAGTCGGAACTGTTGGACAGATCTAGCATTAATCTTATGTCATTGGCGCAAATTATCCAAGGC
GAAAAGGGCGTCCGGATGATGGACCGACGGTGGCATTGGAGGTTACATTATAATTGTTTCATTGGATTTGAATTC
ACAACCTGGCTGTTGCAAAACATACGTGATATCGATACTCGTGAACAGGCAGTTAAATTCGGCAACGAGTTGATC
GATCATGGCTTGTTCCAACATGTGGAGAAGAGACACAATTTCCGAGATGGCAACTATTTCTACCAAGTCTGTGCT
GATTATCGTGTCACTCGTCCAGAGTCTCGAGGAAGCTGGTTCCCTCAACTTAGGACAGACAAATCGATGCCGTCG
ACACCCGCTATCGGGACTGTCAAGGACTCTCCTGCCAGCCTCAAAGCTCGATCAGACAGCATCGACGAGCGCATA
CCACAGACTCCTAGCACTCCCACCAAGGCGAAGAATAAGGTCGCCATCATGTTGTCCAAGTCCATGAAATTCGAT
GTTGATCCGCGCAAGCGGTCGAATCGGCCGGAAGTGATTGATCTTCATTGGGACCGACTACATAACCCCGAGAAT
TGCTTCCATATCGAACTCAGCTGGATGAGCACGACCCCCAAGTTGATTGAAGATACCGTGCTTTCTTGGGCTTCG
ACCGCAGACAAATTCGGGCTGAAATTGGTACAGGTGCCGATCGCCGAAGCCTGTGCTATCGACAAGACGCAGCCA
TTCCGGAAACCCTACAAGGTCACACTCAAGATCCCACCACCCAAAGGGCCATTGCACACTGTGTTCAACAATGCG
TCATTTGCGCAGCCGGGTCCACCGGATCGCCTCTACTATCAGAAGGCCATATTGCGAAAGTTTGATTTCGTACTT
GACTTCGAAGCCTCCTCTGCATTCCCAGCAGACGTTGAAGTCTCTTACTCCTGGGGAAAGCCCGACTACAAGTAC
CCGCAGTTCATCCACCGAACCGGAAGCATCCTCGCGCAGATCACCGACGAAGGTGAGTTCCTTGTCCTTGCGAAT
CGGCTGGTGAGCACCCGCAGCACCGCGAGTCGAGACGCAGCCCGCTTTGAAAACCACAATCGGTCCGACTTCCGA
GGCCGTGATGGACTTGACCGCATCTCGCCCCGACTTTCTCCAATAACCCGGCCCGTTCATGACATTGGAAGCATC
GGCAGCCCACTTACCCCAGCTGGATCAGCAAGCCTCGACGCGGGAAACTTGTACCGCGCTCCGGAACACATTCTT
AATGGCCTATCTGAGTTCTGCAACGATGCAGCCCAACTAGAGCAGTTCTACTCGGAGTCGCATGCTCGTCCGTTA
TCCACGAAGGTGGAATCGACTACCGCAAACCTAATGGATGCATCGATCCCGTCCCTCGAGCTTCCTGCCAGCGTA
GTCAGTCATCATATCCCACTGCCGCCAGGATTACCATCTCGGATCACCCGTGATTCGCGCGACGGACTGATATCA
CCGGAAATTACACTTGCCAGGGCTCGGGCAGAAAGCATCAGCTACAATCCCAGCCCTAGGAGTGGCAGCTTACGA
CCCTTGATCTGA
Transcript >Pro_DTO377G3_2|g9378.t1
ATGTCTTTGCGCGGGCCCATGCGGCGGTCGCACCTGAGGCAAGTGAGCGCGGCGAGCTTGGAAAGCAGCTCCACC
CACTCACTGGAGGCTTCGAACCGTGACCATGACCACGACCAAGCCATAGATGATCGGACTGTCAGGCTTTCATCG
GCAAGCTGGACGCGACACCAATGTGCGCTTTGGGTGCACGATGAGACGTTTTCGCGTGAAGAGATTTTGTTGAAT
CCATCGGCTTTCGGCGAAACTGAAGTGCAAGTTGGCGATCTCGTCGAGATCCTACCCATACGGGGCTCTGGCGAT
AATGGTTATTCTACACTTAAGCCAGAGGCAGCTTCGAAAGCTGCTCGTGAGGGTCATGCCGAACTCAACTCGGCG
GCTCAAACGGACAGCACCTCGAAGTTCAAGACTCCACTGCAGAGCCGTTGTTTATTCGTCGTGAAGGCCTTACCG
CCAGAAACCAAGGCTCGGAATCCTCAATTGGAGATCTCAGTGACCAACAATATTGCCAACATCTTTGGTTTCAAG
AATAGAACTCAAGTTACATTGGCGATTGTGGATCGAGACCAATGTGCAGCGTCTCATGTCGATATTGCCTTTCGC
GATCAATACATGGTCCGATCGGACATGTGGAGACTAGTCATGTCGGAGTTATCAGATAAAATCATGTATAAAGGA
CAAAAGATCATGTTTATGGGAAGCATCAAAGCCACTGTCAAGAACATCTTTATCCGAGAGAAGAAATGCCTTTCG
GGATATTTTTCGCCACATACAATCCCTATTTTCCGAAGCGAGTCCGCCAAATATGTCCTATTCATCCAAATGTCG
AAAGAAATGTGGGACTTTGACTCGGAGGGCACTGGGGACATCCTCTTCAGTCGGGTTATCAATGGTTTCCTACCG
GAGCTCTTCAAGCGATGGGCTAATTCGGACGCCAAACATTTGGTAACTATTGTGCTATTCACTCGAGTCGAATAT
GATAAACCCAACACTCCAGGTCAGCCTAAACTCAGCGCTGGAAACTTGAACAGCAAATTTGGACCAAACAAAGTT
CCAACTCGAGATTTCTACCGTGTGGTAGTAAATGATATGGCAAGCGGCCATTGGACGACCATCCTAGACGAGCTG
AAAAGGGAATTCAGGACCTTCTTACGAGATGTGTCAATTCTAAAACCGGACGACGTTGATCCTGTATCTGGTATC
AAGAACTCCAAGCCAAACATGGCGACCATTGCCGGACACCCAAGTTCAGCTCTACGAGGAAATATTTTAGAGGCC
ATTCATCTCGCTTCTGCTCATCTGGCTTTTGATCATATCGATCGCGACATGGTCCATACTGGCACCTCGATCATT
GTTATCACACCCGGTAGTGGCGTTTTTGAGGTCTCCTACGAGTCCTTGGCTTCTACAACAGAAGCCCTTGCGAAC
CGAGGCATAGCAATTGACTTAGTCTGTTTGAGTCCGATGCCTCTCCATTCTGTGCCACTTTTCAAATACCGGGAG
CCAGTGGAGCAACCTTCTGGGGATTCAGGGGGAGCTAGATCCAGTGAAGTGAACAGGGATAGGATGTCTTCTGAG
ATACACCATTCCCTTTCAAGCGTTGTCAGCAGAACGTCATATCTTTCTCCAAGTTCATACCTGTCTGCAACTAGA
ATGAGGGAGCGGGCAACACCTCAAGCCAAGGAATGGAGCTTTGGCATCCCTCATTGGCTTGATATCTCCTATTGG
AACCCTGAAACGTACCGAGAGTCCCGGCGAATCTTGAAAAAAGACCCAAATGCGCCAATCTCTCTTACCGTCACT
CGTCCATCAAAGGCATTCACGCCACGAGTGCGTATGTATGAGATCCAAATGATGGGAGTTATGGAAAGCGAACAA
GCAAACATCACAATCCCCTACCTTACTGAAGGGCGCGGTGGAACAAGACCTCGTGGATCTTGGCCCGGCTACAAT
TCAGGTAGTCGCGCTCCCCCTAAAACACGTTTCACGAACCCTTCATCTTTCAAGGGACAAGGACAACTTAGTGAT
AGCCTTCGCCGGGGGTCCTTTGTTCAAAACGTGGCAGACCAAAATGAATCGCAGACTCGAGATACGCGGAGTTCA
CGAAAGGCAGTGATGTCTTGGATGGATCAATACGATGAAACCCTTTTCTCTGTCTCTCCAAATCCGCACCAGGGT
ACTAAAGCGCCCAAGGCAAAGCGACCCAGTGAAGCGGAAGTCCAGGCTGCTGGGGGTGGAGTGCATGAACGGTTA
TCTGCCCGTTCTATCACCCGCCTTCGCCATCATGAAACGAATCCAGCAGACGAGAATGATTCTTTGCACTCTGGT
CCTCGAAGAATTGAGTCGAATATGACTACACCAAAAAGCCCAGGATCGGTCAAGAGTATGTCTCCCATAAAACCA
GTGTTGAAAAAGACGCCGGTGCCAATGGCATCACGTATTTCTCGGACAATTAGCTTCGCACTTCGAGGCTTGAGC
GCTACTCCTCCGAGGGCCTTGGCAAGCACAGTGGTAAATGTAGAACATGCCAGTGCTATGCCGATGACAAACCAA
AGAACTCCTGCCGGATCAATTTCCGATACCAGGAGCATCACTTCTTTGAGTCCGTCAGAAACTGCATCGACTACA
TCGGTCTTTGAGGTATTTCCGACGCCTTCAACACCCGCCAAGTCGTCCCAAACTCCCGCTAAGCCGATTTCCATC
AAAATGCCTCCCAAAAATCCACCAAAGGAATCCGAACGGCCAGAGGATGCGGGCCCCCATGGATCGCTGTCGATG
GACACGCCAGCGAATGAAGTCGGTCGGGGCCATGGCGATCCTCCGAACGATCACAATATCGAGATCACTCTCAGC
CATAGTCCGCGCGAGCTACATGCGCGGAGCTCCCCGAGCAAAGCTTTAGCCCCGTGGGTCCGATCGGTCAACCCA
TGCAATACCCCTAAAGATGTGCTGCGAGATATTAGTTGGTTTGGTCGTTGGCAACATGCGTATCCTCGGCCCCCA
CATGTGGCTGTGGTGAAGTGGAAGAGTTTGAAGTCTCCTGCGGTGCTTCCATTGACAACTGAAGAATTTCCGACA
GCTAGCGTGCTTGCTTCAGACTATCTACAGACACCATATCGTGTCTTCCCAAATGAAGATTCCGAAGGCATTGAA
GCACCAAAGACACGCGGGGTACTTTTACGAGAAATGATCTCGCTGCGGCTTTCTCATGGCTTCCAACTCATTGTT
GGAAAACATGTGGCTGAAGTTTCTGCGCAGCCCACCCTTGAATCATTAAACGTCTTCGATTTCCGAGGTCTAGAG
CGCGATGGGCTCACAGTGTTTCTCTCCAAAGGCAACGCGATTCACCGACTTGTCTGCCTCCAAGGGGGAGAAGTT
GAAGTGACCCGCTTTACGCATCAAAACTCTGCGGTGATCATTTCTCCCAAAAAGCCTACCTTTACTCTTTATCAA
CCGGCGATGAAAACAATATTAAGCGCGGAATACGAAGTGAAGGACATCAAGCTGGATCCAACCTCCGAAGAGTAC
AACTGGAACTATGCCGATAATTATGTGGCTGGTCATCGAGATTATCTCCAAAATCCAGCGCAGCAGCTGCAATTC
TGGCGAGTCCGTTACGTCTTGATTCCGCTTCAACTCCATGCCAATTCTCGGCGGAATTTGCAAACTTCTCATGAG
GATAACGAAGAAGAAATTCATTTGCTGGGTATCAGCCAACTGACCCATATTTGGCAACGATTCAAATACGTGTCG
CCGGAGGAAAAGCTTTTCGAGACGTCAAATCCCAAGCGAGACCAGAATCCCTTGAATATCATGTACCAAACACGC
AATCCATCGGAAATCGTTACGGCAGAGCTGGATCGTTTGCTACTCACTGATCCAGGGCTCGACAATGCCCCGGCT
CAGCTCTTGCCGGAGTCGGAACTGTTGGACAGATCTAGCATTAATCTTATGTCATTGGCGCAAATTATCCAAGGC
GAAAAGGGCGTCCGGATGATGGACCGACGGTGGCATTGGAGGTTACATTATAATTGTTTCATTGGATTTGAATTC
ACAACCTGGCTGTTGCAAAACATACGTGATATCGATACTCGTGAACAGGCAGTTAAATTCGGCAACGAGTTGATC
GATCATGGCTTGTTCCAACATGTGGAGAAGAGACACAATTTCCGAGATGGCAACTATTTCTACCAAGTCTGTGCT
GATTATCGTGTCACTCGTCCAGAGTCTCGAGGAAGCTGGTTCCCTCAACTTAGGACAGACAAATCGATGCCGTCG
ACACCCGCTATCGGGACTGTCAAGGACTCTCCTGCCAGCCTCAAAGCTCGATCAGACAGCATCGACGAGCGCATA
CCACAGACTCCTAGCACTCCCACCAAGGCGAAGAATAAGGTCGCCATCATGTTGTCCAAGTCCATGAAATTCGAT
GTTGATCCGCGCAAGCGGTCGAATCGGCCGGAAGTGATTGATCTTCATTGGGACCGACTACATAACCCCGAGAAT
TGCTTCCATATCGAACTCAGCTGGATGAGCACGACCCCCAAGTTGATTGAAGATACCGTGCTTTCTTGGGCTTCG
ACCGCAGACAAATTCGGGCTGAAATTGGTACAGGTGCCGATCGCCGAAGCCTGTGCTATCGACAAGACGCAGCCA
TTCCGGAAACCCTACAAGGTCACACTCAAGATCCCACCACCCAAAGGGCCATTGCACACTGTGTTCAACAATGCG
TCATTTGCGCAGCCGGGTCCACCGGATCGCCTCTACTATCAGAAGGCCATATTGCGAAAGTTTGATTTCGTACTT
GACTTCGAAGCCTCCTCTGCATTCCCAGCAGACGTTGAAGTCTCTTACTCCTGGGGAAAGCCCGACTACAAGTAC
CCGCAGTTCATCCACCGAACCGGAAGCATCCTCGCGCAGATCACCGACGAAGGTGAGTTCCTTGTCCTTGCGAAT
CGGCTGGTGAGCACCCGCAGCACCGCGAGTCGAGACGCAGCCCGCTTTGAAAACCACAATCGGTCCGACTTCCGA
GGCCGTGATGGACTTGACCGCATCTCGCCCCGACTTTCTCCAATAACCCGGCCCGTTCATGACATTGGAAGCATC
GGCAGCCCACTTACCCCAGCTGGATCAGCAAGCCTCGACGCGGGAAACTTGTACCGCGCTCCGGAACACATTCTT
AATGGCCTATCTGAGTTCTGCAACGATGCAGCCCAACTAGAGCAGTTCTACTCGGAGTCGCATGCTCGTCCGTTA
TCCACGAAGGTGGAATCGACTACCGCAAACCTAATGGATGCATCGATCCCGTCCCTCGAGCTTCCTGCCAGCGTA
GTCAGTCATCATATCCCACTGCCGCCAGGATTACCATCTCGGATCACCCGTGATTCGCGCGACGGACTGATATCA
CCGGAAATTACACTTGCCAGGGCTCGGGCAGAAAGCATCAGCTACAATCCCAGCCCTAGGAGTGGCAGCTTACGA
CCCTTGATCTGA
Gene >Pro_DTO377G3_2|g9378.t1
ATGTCTTTGCGCGGGCCCATGCGGCGGTCGCACCTGAGGCAAGTGAGCGCGGCGAGCTTGGAAAGCAGCTCCACC
CACTCACTGGAGGCTTCGAACCGTGACCATGACCACGACCAAGCCATAGATGATCGGACTGTCAGGCTTTCATCG
GCAAGCTGGACGCGACACCAATGTGCGCTTTGGGTGCACGATGAGACGTTTTCGCGTGAAGAGATTTTGTTGAAT
CCATCGGCTTTCGGCGAAACTGAAGTGCAAGTTGGCGATCTCGTCGAGATCCTACCCATACGGGGCTCTGGCGAT
AATGGTTATTCTACACTTAAGCCAGAGGCAGCTTCGAAAGCTGCTCGTGAGGGTCATGCCGAACTCAACTCGGCG
GCTCAAACGGACAGCACCTCGAAGTTCAAGACTCCACTGCAGAGCCGTTGTTTATTCGTCGTGAAGGCCTTACCG
CCAGAAACCAAGGCTCGGAATCCTCAATTGGAGATCTCAGTGACCAACAATATTGCCAACATCTTTGGTTTCAAG
AATAGAACTCAAGTTACATTGGCGATTGTGGATCGAGACCAATGTGCAGCGTCTCATGTCGATATTGCCTTTCGC
GATCAATACATGGTCCGATCGGACATGTGGAGACTAGTCATGTCGGAGTTATCAGATAAAATCATGTATAAAGGA
CAAAAGATCATGTTTATGGGAAGCATCAAAGCCACTGTCAAGAACATCTTTATCCGAGAGAAGAAATGCCTTTCG
GGATATTTTTCGCCACATACAATCCCTATTTTCCGAAGCGAGTCCGCCAAATATGTCCTATTCATCCAAATGTCG
AAAGAAATGTGGGACTTTGACTCGGAGGGCACTGGGGACATCCTCTTCAGTCGGGTTATCAATGGTTTCCTACCG
GAGCTCTTCAAGCGATGGGCTAATTCGGACGCCAAACATTTGGTAACTATTGTGCTATTCACTCGAGTCGAATAT
GATAAACCCAACACTCCAGGTCAGCCTAAACTCAGCGCTGGAAACTTGAACAGCAAATTTGGACCAAACAAAGTT
CCAACTCGAGATTTCTACCGTGTGGTAGTAAATGATATGGCAAGCGGCCATTGGACGACCATCCTAGACGAGCTG
AAAAGGGAATTCAGGACCTTCTTACGAGATGTGTCAATTCTAAAACCGGACGACGTTGATCCTGTATCTGGTATC
AAGAACTCCAAGCCAAACATGGCGACCATTGCCGGACACCCAAGTTCAGCTCTACGAGGAAATATTTTAGAGGCC
ATTCATCTCGCTTCTGCTCATCTGGCTTTTGATCATATCGATCGCGACATGGTCCATACTGGCACCTCGATCATT
GTTATCACACCCGGTAGTGGCGTTTTTGAGGTCTCCTACGAGTCCTTGGCTTCTACAACAGAAGCCCTTGCGAAC
CGAGGCATAGCAATTGACTTAGTCTGTTTGAGTCCGATGCCTCTCCATTCTGTGCCACTTTTCAAATACCGGGAG
CCAGTGGAGCAACCTTCTGGGGATTCAGGGGGAGCTAGATCCAGTGAAGTGAACAGGGATAGGATGTCTTCTGAG
ATACACCATTCCCTTTCAAGCGTTGTCAGCAGAACGTCATATCTTTCTCCAAGTTCATACCTGTCTGCAACTAGA
ATGAGGGAGCGGGCAACACCTCAAGCCAAGGAATGGAGCTTTGGCATCCCTCATTGGCTTGATATCTCCTATTGG
AACCCTGAAACGTACCGAGAGTCCCGGCGAATCTTGAAAAAAGACCCAAATGCGCCAATCTCTCTTACCGTCACT
CGTCCATCAAAGGCATTCACGCCACGAGTGCGTATGTATGAGATCCAAATGATGGGAGTTATGGAAAGCGAACAA
GCAAACATCACAATCCCCTACCTTACTGAAGGGCGCGGTGGAACAAGACCTCGTGGATCTTGGCCCGGCTACAAT
TCAGGTAGTCGCGCTCCCCCTAAAACACGTTTCACGAACCCTTCATCTTTCAAGGGACAAGGACAACTTAGTGAT
AGCCTTCGCCGGGGGTCCTTTGTTCAAAACGTGGCAGACCAAAATGAATCGCAGACTCGAGATACGCGGAGTTCA
CGAAAGGCAGTGATGTCTTGGATGGATCAATACGATGAAACCCTTTTCTCTGTCTCTCCAAATCCGCACCAGGGT
ACTAAAGCGCCCAAGGCAAAGCGACCCAGTGAAGCGGAAGTCCAGGCTGCTGGGGGTGGAGTGCATGAACGGTTA
TCTGCCCGTTCTATCACCCGCCTTCGCCATCATGAAACGAATCCAGCAGACGAGAATGATTCTTTGCACTCTGGT
CCTCGAAGAATTGAGTCGAATATGACTACACCAAAAAGCCCAGGATCGGTCAAGAGTATGTCTCCCATAAAACCA
GTGTTGAAAAAGACGCCGGTGCCAATGGCATCACGTATTTCTCGGACAATTAGCTTCGCACTTCGAGGCTTGAGC
GCTACTCCTCCGAGGGCCTTGGCAAGCACAGTGGTAAATGTAGAACATGCCAGTGCTATGCCGATGACAAACCAA
AGAACTCCTGCCGGATCAATTTCCGATACCAGGAGCATCACTTCTTTGAGTCCGTCAGAAACTGCATCGACTACA
TCGGTCTTTGAGGTATTTCCGACGCCTTCAACACCCGCCAAGTCGTCCCAAACTCCCGCTAAGCCGATTTCCATC
AAAATGCCTCCCAAAAATCCACCAAAGGAATCCGAACGGCCAGAGGATGCGGGCCCCCATGGATCGCTGTCGATG
GACACGCCAGCGAATGAAGTCGGTCGGGGCCATGGCGATCCTCCGAACGATCACAATATCGAGATCACTCTCAGC
CATAGTCCGCGCGAGCTACATGCGCGGAGCTCCCCGAGCAAAGCTTTAGCCCCGTGGGTCCGATCGGTCAACCCA
TGCAATACCCCTAAAGATGTGCTGCGAGATATTAGTTGGTTTGGTCGTTGGCAACATGCGTATCCTCGGCCCCCA
CATGTGGCTGTGGTGAAGTGGAAGAGTTTGAAGTCTCCTGCGGTGCTTCCATTGACAACTGAAGAATTTCCGACA
GCTAGCGTGCTTGCTTCAGACTATCTACAGACACCATATCGTGTCTTCCCAAATGAAGATTCCGAAGGCATTGAA
GCACCAAAGACACGCGGGGTACTTTTACGAGAAATGATCTCGCTGCGGCTTTCTCATGGCTTCCAACTCATTGTT
GGAAAACATGTGGCTGAAGTTTCTGCGCAGCCCACCCTTGAATCATTAAACGTCTTCGATTTCCGAGGTCTAGAG
CGCGATGGGCTCACAGTGTTTCTCTCCAAAGGCAACGCGATTCACCGACTTGTCTGCCTCCAAGGGGGAGAAGTT
GAAGTGACCCGCTTTACGCATCAAAACTCTGCGGTGATCATTTCTCCCAAAAAGCCTACCTTTACTCTTTATCAA
CCGGCGATGAAAACAATATTAAGCGCGGAATACGAAGTGAAGGACATCAAGCTGGATCCAACCTCCGAAGAGTAC
AACTGGAACTATGCCGATAATTATGTGGCTGGTCATCGAGATTATCTCCAAAATCCAGCGCAGCAGCTGCAATTC
TGGCGAGTCCGTTACGTCTTGATTCCGCTTCAACTCCATGCCAATTCTCGGCGGAATTTGCAAACTTCTCATGAG
GATAACGAAGAAGAAATTCATTTGCTGGGTATCAGCCAACTGACCCATATTTGGCAACGATTCAAATACGTGTCG
CCGGAGGAAAAGCTTTTCGAGACGTCAAATCCCAAGCGAGACCAGAATCCCTTGAATATCATGTACCAAACACGC
AATCCATCGGAAATCGTTACGGCAGAGCTGGATCGTTTGCTACTCACTGATCCAGGGCTCGACAATGCCCCGGCT
CAGCTCTTGCCGGAGTCGGAACTGTTGGACAGATCTAGCATTAATCTTATGTCATTGGCGCAAATTATCCAAGGC
GAAAAGGGCGTCCGGATGATGGACCGACGGTGGCATTGGAGGTTACATTATAATTGTTTCATTGGATTTGAATTC
ACAACCTGGCTGTTGCAAAACATACGTGATATCGATACTCGTGAACAGGCAGTTAAATTCGGCAACGAGTTGATC
GATCATGGCTTGTTCCAACATGTGGAGAAGAGACACAATTTCCGAGATGGCAACTATTTCTACCAAGTCTGTGCT
GATTATCGTGTCACTCGTCCAGAGTCTCGAGGAAGCTGGTTCCCTCAACTTAGGACAGACAAATCGATGCCGTCG
ACACCCGCTATCGGGACTGTCAAGGACTCTCCTGCCAGCCTCAAAGCTCGATCAGACAGCATCGACGAGCGCATA
CCACAGACTCCTAGCACTCCCACCAAGGCGAAGAATAAGGTCGCCATCATGTTGTCCAAGTCCATGAAATTCGAT
GTTGATCCGCGCAAGCGGTCGAATCGGCCGGAAGTGATTGATCTTCATTGGGACCGACTACATAACCCCGAGAAT
TGCTTCCATATCGAACTCAGCTGGATGAGCACGACCCCCAAGTTGATTGAAGATACCGTGCTTTCTTGGGCTTCG
ACCGCAGACAAATTCGGGCTGAAATTGGTACAGGTGCCGATCGCCGAAGCCTGTGCTATCGACAAGACGCAGCCA
TTCCGGAAACCCTACAAGGTCACACTCAAGATCCCACCACCCAAAGGGCCATTGCACACTGTGTTCAACAATGCG
TCATTTGCGCAGCCGGGTCCACCGGATCGCCTCTACTATCAGAAGGCCATATTGCGAAAGTTTGATTTCGTACTT
GACTTCGAAGCCTCCTCTGCATTCCCAGCAGACGTTGAAGTCTCTTACTCCTGGGGAAAGCCCGACTACAAGTAC
CCGCAGTTCATCCACCGAACCGGAAGCATCCTCGCGCAGATCACCGACGAAGGTGAGTTCCTTGTCCTTGCGAAT
CGGCTGGTGAGCACCCGCAGCACCGCGAGTCGAGACGCAGCCCGCTTTGAAAACCACAATCGGTCCGACTTCCGA
GGCCGTGATGGACTTGACCGCATCTCGCCCCGACTTTCTCCAATAACCCGGCCCGTTCATGACATTGGAAGCATC
GGCAGCCCACTTACCCCAGCTGGATCAGCAAGCCTCGACGCGGGAAACTTGTACCGCGCTCCGGAACACATTCTT
AATGGCCTATCTGAGTTCTGCAACGATGCAGCCCAACTAGAGCAGTTCTACTCGGAGTCGCATGCTCGTCCGTTA
TCCACGAAGGTGGAATCGACTACCGCAAACCTAATGGATGCATCGATCCCGTCCCTCGAGCTTCCTGCCAGCGTA
GTCAGTCATCATATCCCACTGCCGCCAGGATTACCATCTCGGATCACCCGTGATTCGCGCGACGGACTGATATCA
CCGGAAATTACACTTGCCAGGGCTCGGGCAGAAAGCATCAGCTACAATCCCAGCCCTAGGAGTGGCAGCTTACGA
CCCTTGATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail