Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9374.t1
Gene name
Locationscaffold_46:71615..73407
Strand+
Gene length (bp)1792
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00485 PRK Phosphoribulokinase / Uridine kinase family 7.1E-60 25 213
PF14681 UPRTase Uracil phosphoribosyltransferase 5.9E-39 256 439

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016301 kinase activity Yes
GO:0005488 binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0016740 transferase activity No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9374.t1
MESISPLFSSSTEVRYSPPWQDLSIIGIAGSSGSGKSSVAMEIVKSLNLPWVVILVMDSFYKTLTPEQHHKAHAN
EYDFDCPESIDFDILVETLRDLKKGKKANIPIYSFAEHQRQRNTTTLYSPHVIILEGILALHDPRIVEMLDVKIF
VEADMDVCLGRRILRDVRERGRDIEGIIKQWFEFVKPSYTRFVEPQRSISDIIIPRGIENKTAIDMVVKHIQRKL
QEKSDNHTEALRKLGLVAAEVELPSNVHVLPSTPQIIGMNTILQTPETQQEDFIFYFDRLVSILIERALDMTSYV
SANVETPQGSTYLGLHPKGIVSAVAILRGGSCMETALKRSIPDCLTGRLLIQTNESNEEPELHYLKLPSRIEEHT
TVILIDSQMSSGGAALMAVRVLIDHGVEQGRIVFVTCAAGERGLKRLTAVYPRINVIVGRIEEEGEPRWIEKRYF
GC*
Coding >Pro_DTO377G3_2|g9374.t1
ATGGAATCAATCTCGCCTTTATTTTCTTCGTCCACCGAAGTGCGATATTCTCCACCATGGCAGGACTTGAGCATT
ATTGGCATTGCTGGCAGCTCTGGCTCCGGTAAGAGCTCTGTGGCAATGGAGATTGTCAAGTCTTTGAACTTGCCG
TGGGTGGTGATCCTTGTAATGGACTCATTTTACAAGACCTTAACTCCTGAGCAACACCACAAGGCCCACGCAAAT
GAATATGACTTCGACTGCCCGGAATCGATTGACTTTGATATTCTGGTGGAAACCCTCCGTGATCTGAAGAAAGGA
AAGAAAGCGAACATCCCAATTTACTCATTTGCTGAGCACCAGCGGCAGCGTAATACGACCACCCTCTACTCCCCT
CATGTGATCATTCTCGAGGGGATTTTGGCGCTCCATGATCCCAGAATTGTCGAGATGTTGGATGTGAAGATCTTT
GTTGAAGCAGATATGGATGTGTGCTTAGGTCGCAGAATCTTGCGTGACGTCCGTGAGCGAGGGCGGGATATTGAA
GGAATCATCAAACAATGGTTTGAATTTGTGAAGCCTTCTTACACTCGTTTTGTGGAGCCTCAACGCTCTATCTCA
GACATCATTATCCCGCGTGGCATTGAGAACAAGACCGCTATTGACATGGTGGTCAAACACATTCAACGCAAGCTG
CAGGAGAAATCTGATAACCATACCGAAGCGCTTCGCAAACTAGGTTTGGTTGCAGCAGAAGTGGAGCTGCCTTCA
AATGTACACGTCTTGCCCTCGACACCGCAGATTATTGGCATGAATACTATTCTGCAGACCCCAGAAACCCAGCAA
GAGGATTTCATATTTTACTTTGATCGACTGGTTTCGATCTTGATTGAAAGGGCCCTGGATATGACATCGTATGTA
TCCGCAAATGTGGAAACACCACAAGGGAGCACGTACCTCGGTTTGCACCCCAAGGGTATCGTATCAGCCGTGGCT
ATCTTACGTGGAGGCTCTTGCATGGAGACCGCGCTTAAGCGATCCATTCCCGACTGTCTCACTGGTCGTTTGCTC
ATTCAAACGAACGAGAGCAACGAGGAGCCGGAGTTGCATTACTTGAAACTTCCGTCTCGTATCGAAGAGCATACA
ACTGTCATACTAATTGACTCTCAGATGTCAAGTGGAGGTGCTGCACTTATGGCTGTTCGCGTCTTGATTGATCAT
GGGGTGGAACAAGGGAGGATCGTTTTCGTAACTTGTGCAGCAGGTGAACGGGGCCTTAAGAGGCTCACTGCCGTA
TACCCTAGGATCAATGTGATTGTTGGACGTATCGAAGAAGAAGGAGAACCGCGCTGGATAGAGAAGCGATACTTC
GGATGCTGA
Transcript >Pro_DTO377G3_2|g9374.t1
ATGGAATCAATCTCGCCTTTATTTTCTTCGTCCACCGAAGTGCGATATTCTCCACCATGGCAGGACTTGAGCATT
ATTGGCATTGCTGGCAGCTCTGGCTCCGGTAAGAGCTCTGTGGCAATGGAGATTGTCAAGTCTTTGAACTTGCCG
TGGGTGGTGATCCTTGTAATGGACTCATTTTACAAGACCTTAACTCCTGAGCAACACCACAAGGCCCACGCAAAT
GAATATGACTTCGACTGCCCGGAATCGATTGACTTTGATATTCTGGTGGAAACCCTCCGTGATCTGAAGAAAGGA
AAGAAAGCGAACATCCCAATTTACTCATTTGCTGAGCACCAGCGGCAGCGTAATACGACCACCCTCTACTCCCCT
CATGTGATCATTCTCGAGGGGATTTTGGCGCTCCATGATCCCAGAATTGTCGAGATGTTGGATGTGAAGATCTTT
GTTGAAGCAGATATGGATGTGTGCTTAGGTCGCAGAATCTTGCGTGACGTCCGTGAGCGAGGGCGGGATATTGAA
GGAATCATCAAACAATGGTTTGAATTTGTGAAGCCTTCTTACACTCGTTTTGTGGAGCCTCAACGCTCTATCTCA
GACATCATTATCCCGCGTGGCATTGAGAACAAGACCGCTATTGACATGGTGGTCAAACACATTCAACGCAAGCTG
CAGGAGAAATCTGATAACCATACCGAAGCGCTTCGCAAACTAGGTTTGGTTGCAGCAGAAGTGGAGCTGCCTTCA
AATGTACACGTCTTGCCCTCGACACCGCAGATTATTGGCATGAATACTATTCTGCAGACCCCAGAAACCCAGCAA
GAGGATTTCATATTTTACTTTGATCGACTGGTTTCGATCTTGATTGAAAGGGCCCTGGATATGACATCGTATGTA
TCCGCAAATGTGGAAACACCACAAGGGAGCACGTACCTCGGTTTGCACCCCAAGGGTATCGTATCAGCCGTGGCT
ATCTTACGTGGAGGCTCTTGCATGGAGACCGCGCTTAAGCGATCCATTCCCGACTGTCTCACTGGTCGTTTGCTC
ATTCAAACGAACGAGAGCAACGAGGAGCCGGAGTTGCATTACTTGAAACTTCCGTCTCGTATCGAAGAGCATACA
ACTGTCATACTAATTGACTCTCAGATGTCAAGTGGAGGTGCTGCACTTATGGCTGTTCGCGTCTTGATTGATCAT
GGGGTGGAACAAGGGAGGATCGTTTTCGTAACTTGTGCAGCAGGTGAACGGGGCCTTAAGAGGCTCACTGCCGTA
TACCCTAGGATCAATGTGATTGTTGGACGTATCGAAGAAGAAGGAGAACCGCGCTGGATAGAGAAGCGATACTTC
GGATGCTGA
Gene >Pro_DTO377G3_2|g9374.t1
ATGGAATCAATCTCGCCTTTATTTTCTTCGTCCACCGAAGTGCGATATTCTCCACCATGGCAGGACTTGAGCATT
ATTGGCATTGCTGGCAGCTCTGGCTCCGGTAAGAGCTCTGTGGCAATGGAGATTGTCAAGTCTTTGAACTTGCCG
TGGGTGGTGATCCTTGTAATGGTACAGCTTGTGAACTGCATATAAATCGAGACCTTGTTCTAATGTGTTCTATAC
AGGACTCATTTTACAAGACCTTAACTCCTGAGCAACACCACAAGGCCCACGCAAATGAATATGACTTCGACTGCC
CGGAATCGATTGACTTTGATATTCTGGTGGAAACCCTCCGTGATCTGAAGAAAGGGTAAATTTACTGTTCTTGCT
AGAGTCCTTCTATTTGACCTGACTGAATATCACACAGAAAGAAAGCGAACATCCCAATTTACTCATTTGCTGAGC
ACCAGCGGCAGCGTAATACGACCACCCTCTACTCCCCTCATGTGATCATTCTCGAGGGGATTTTGGCGCTCCATG
ATCCCAGAATTGTCGAGATGTTGGATGTGAAGGTATTATAGTTTCTGTGCTATCATTGTGCTTATCCGTGCTAAT
TTGATGGCCCAGATCTTTGTTGAAGCAGATATGGATGTGTGCTTAGGTCGCAGAAGTAAGTTATCTCAACCGGGC
TACTGAACCCAGCTGACAATGTATAGTCTTGCGTGACGTCCGTGAGCGAGGGCGGGATATTGAAGGAATCATCAA
ACAATGGTTTGAATTTGTGAAGCCTTCTTACACTCGTTTTGTGGAGCCTCAACGCTCTATCTCAGGTTGGTAGCC
ATATGACTTTACAAAGCATTGGGATACCATTGTTAATTTTGAATCCTAGACATCATTATCCCGCGTGGCATTGAG
AACAAGACCGCTATTGGTGTGCAACCCCTGGAGCTGCTCGTTTTGAGACCTATACACTAACTAATTCAGACATGG
TGGTCAAACACATTCAACGCAAGCTGCAGGAGAAATCTGATAACCATACCGAAGCGCTTCGCAAACTAGGTTTGG
TTGCAGCAGAAGTGGAGCTGCCTTCAAATGTACACGTCTTGCCCTCGACACCGCAGATTATTGGCATGAATACTA
TTCTGCAGACCCCAGAAACCCAGCAAGAGGATTTCATATTTTACTTTGATCGACTGGTTTCGATCTTGATTGAAA
GGTACTGCGCTCCTTCATGCTCCCAATTCCCAACGATACGCCCACAGAAGAACTTGAGTCCTGTGAGCATAGCGC
CTTCTAGTTGCTTTACTGACACCACTGTTGCAGGGCCCTGGATATGACATCGTATGTATCCGCAAATGTGGAAAC
ACCACAAGGGAGCACGTACCTCGGTTTGCACCCCAAGGGTATCGTATCAGCCGTGGCTATCTTACGTGGAGGCTC
TTGCATGGAGACCGCGCTTAAGCGATCCATTCCCGACTGTCTCACTGGTCGTTTGCTCATTCAAACGAACGAGAG
CAACGAGGAGCCGGAGTTGCATTACTTGAAACTTCCGTCTCGTATCGAAGAGCATACAACTGTCATACTAATTGA
CTCTCAGATGTCAAGTGGAGGTGCTGCACTTATGGCTGTTCGCGTCTTGATTGATCATGGGGTGGAACAAGGGAG
GATCGTTTTCGTAACTTGTGCAGCAGGTGAACGGGGCCTTAAGAGGCTCACTGCCGTATACCCTAGGATCAATGT
GATTGTTGGACGTATCGAAGAAGAAGGAGAACCGCGCTGGATAGAGAAGCGATACTTCGGATGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail