Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9335.t1
Gene name
Locationscaffold_45:106526..107195
Strand-
Gene length (bp)669
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family 6.0E-26 82 192

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 181 198 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 112.03 63.99 160.08
5d_25C Five days - 25 degrees Celsius 99.01 55.39 142.62
7d_25C Seven days - 25 degrees Celsius 96.68 53.88 139.48
10d_25C Ten days - 25 degrees Celsius 113.63 65.07 162.19
7d_15C Seven days - 15 degrees Celsius 93.50 51.48 135.51
7d_30C Seven days - 30 degrees Celsius 107.71 60.93 154.49

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.691512 no
3d_25C 7d_25C 0.628189 no
3d_25C 7d_15C 0.535952 no
3d_25C 7d_30C 0.913564 no
3d_25C 10d_25C 0.971867 no
5d_25C 7d_25C 0.952800 no
5d_25C 7d_15C 0.877537 no
5d_25C 7d_30C 0.800650 no
5d_25C 10d_25C 0.651290 no
7d_25C 7d_15C 0.933233 no
7d_25C 7d_30C 0.734070 no
7d_25C 10d_25C 0.582121 no
7d_15C 7d_30C 0.648473 no
7d_15C 10d_25C 0.502056 no
7d_30C 10d_25C 0.880927 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9335.t1
MSIWDSLSGRKQTGPEAFDPSTAQDATSFLSEVAIPDPSRLHPLAGLNQDTLDYLSLDDTALDELPGSRSVLPSR
GWSDDLCYGAGTTYLVALATGGAWGLVEGLKKTPPTAAPKIRLNGVLNSVTRRGPFLGNSAGVVAMVYNGFNSSL
GYVRGKHDATNSIVAGALSGMVFKSTRGLKPMMISGGIVATIAGAWAVTRRAFF*
Coding >Pro_DTO377G3_2|g9335.t1
ATGTCCATCTGGGACTCCCTCAGCGGCCGCAAGCAAACCGGGCCCGAGGCCTTCGACCCTTCAACCGCGCAAGAT
GCCACATCCTTCCTCTCCGAGGTCGCTATTCCCGATCCCTCTCGCCTCCATCCTCTGGCTGGTTTGAACCAGGAT
ACCCTCGACTACCTCTCCCTCGATGACACTGCCCTTGACGAACTCCCCGGCTCCCGATCAGTGTTGCCATCCCGT
GGATGGTCAGATGACCTTTGTTATGGTGCCGGTACTACCTATCTCGTTGCACTCGCTACTGGAGGCGCGTGGGGA
CTTGTAGAAGGATTGAAAAAGACACCACCCACGGCAGCACCCAAAATTCGACTCAACGGTGTACTCAACTCCGTT
ACCCGTCGCGGTCCGTTCCTCGGAAACTCGGCTGGTGTTGTAGCTATGGTTTACAACGGATTCAACTCCAGCCTC
GGATATGTGCGAGGCAAGCATGACGCGACTAACAGCATCGTGGCCGGCGCATTGAGCGGCATGGTCTTCAAGAGC
ACGCGTGGACTTAAGCCAATGATGATCTCTGGCGGCATTGTGGCTACCATTGCTGGTGCCTGGGCTGTGACCCGA
AGGGCCTTCTTCTAG
Transcript >Pro_DTO377G3_2|g9335.t1
ATGTCCATCTGGGACTCCCTCAGCGGCCGCAAGCAAACCGGGCCCGAGGCCTTCGACCCTTCAACCGCGCAAGAT
GCCACATCCTTCCTCTCCGAGGTCGCTATTCCCGATCCCTCTCGCCTCCATCCTCTGGCTGGTTTGAACCAGGAT
ACCCTCGACTACCTCTCCCTCGATGACACTGCCCTTGACGAACTCCCCGGCTCCCGATCAGTGTTGCCATCCCGT
GGATGGTCAGATGACCTTTGTTATGGTGCCGGTACTACCTATCTCGTTGCACTCGCTACTGGAGGCGCGTGGGGA
CTTGTAGAAGGATTGAAAAAGACACCACCCACGGCAGCACCCAAAATTCGACTCAACGGTGTACTCAACTCCGTT
ACCCGTCGCGGTCCGTTCCTCGGAAACTCGGCTGGTGTTGTAGCTATGGTTTACAACGGATTCAACTCCAGCCTC
GGATATGTGCGAGGCAAGCATGACGCGACTAACAGCATCGTGGCCGGCGCATTGAGCGGCATGGTCTTCAAGAGC
ACGCGTGGACTTAAGCCAATGATGATCTCTGGCGGCATTGTGGCTACCATTGCTGGTGCCTGGGCTGTGACCCGA
AGGGCCTTCTTCTAG
Gene >Pro_DTO377G3_2|g9335.t1
ATGTCCATCTGGGACTCCCTCAGCGGCCGCAAGCAAACCGGGCCCGAGGCCTTCGACCCTTCAACCGCGCAAGAT
GCCACATCCTTCCTCTCCGAGGTCGCTATTCCCGATCCCTCTCGCCTCCATCCTCTGGCTGGTTTGAACCAGGAT
ACCCTCGACTACCTCTCCCTCGATGACACTGCCCTTGACGAACTCCCCGGCTCCCGATCAGTGTTGCCATCCCGT
GGATGGTCAGATGACCTTTGTTATGGTGCCGGTACTACCTATCTCGTTGCACTCGCTACTGGAGGCGCGTGGGGA
CTTGTAGAAGGATTGAAAAAGACACCACCCACGGCAGCACCCAAAATTCGACTCAACGGTGTACTCAACTCCGTT
ACCCGTCGCGGTCCGTTCCTCGGAAACTCGGCTGGTGTTGTAGCTATGGTTTACAACGGATTCAACTCCAGCCTC
GGATATGTGCGAGGCAAGCATGACGCGACTAACAGCATCGTGGCCGGCGCATTGAGCGGCATGGTCTTCAAGAGC
ACGCGTGGACTTAAGCCAATGATGATCTCTGGCGGCATTGTGGCTACCATTGCTGGTGCCTGGGCTGTATGTATA
TTGCTGTGATATGCTGCCTGATTTTTGCTAACCTCGATCCTACAGGTGACCCGAAGGGCCTTCTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail