Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9329.t1
Gene name
Locationscaffold_45:91289..92404
Strand+
Gene length (bp)1115
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 36.87 19.23 54.50
5d_25C Five days - 25 degrees Celsius 30.64 15.22 46.06
7d_25C Seven days - 25 degrees Celsius 28.78 14.13 43.44
10d_25C Ten days - 25 degrees Celsius 24.19 11.25 37.14
7d_15C Seven days - 15 degrees Celsius 33.56 17.01 50.11
7d_30C Seven days - 30 degrees Celsius 32.24 16.02 48.45

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.570248 no
3d_25C 7d_25C 0.412549 no
3d_25C 7d_15C 0.796074 no
3d_25C 7d_30C 0.705863 no
3d_25C 10d_25C 0.150824 no
5d_25C 7d_25C 0.880610 no
5d_25C 7d_15C 0.813222 no
5d_25C 7d_30C 0.906703 no
5d_25C 10d_25C 0.495223 no
7d_25C 7d_15C 0.655325 no
7d_25C 7d_30C 0.767240 no
7d_25C 10d_25C 0.632307 no
7d_15C 7d_30C 0.925584 no
7d_15C 10d_25C 0.288933 no
7d_30C 10d_25C 0.379689 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9329.t1
MERYSQFRDRGSGIAPFLPIPVEPLGLQTPLRIFLFCFRLPLFIFVTLSYFLILQWLPIGSLGKKAALWCILGVP
SIWWIDLQVDGVRKGSLKQQQARLPQPGSVIASSFTSPIDAVYLAAIFDPIFTASYPNTRQVERISLFQAILRAF
ASPATQPAPGALMVDVSSLVEKYPNRPIVLFPECTTTNGRGILTLSNSLLSVPPKTKIFPVSLRYTPMDIVTPLP
GSYMSLLWTLLSKPTHCIRVRIAECITRSQNAIDTAPSLATAKSTYNTNYLDTLDRDGQELASSSEKALLDNVGE
SLARLGRVKRVGLGVKEKQEFSRAWSKSRRTW*
Coding >Pro_DTO377G3_2|g9329.t1
ATGGAGAGATACTCACAGTTTCGGGATCGAGGCTCGGGAATTGCACCCTTCCTCCCGATCCCCGTTGAACCACTC
GGCCTCCAAACGCCTCTTCGCATTTTCCTTTTCTGCTTCCGCCTCCCGCTATTTATTTTCGTCACTCTTAGCTAT
TTTTTGATCCTACAATGGCTTCCTATCGGATCGCTGGGCAAAAAGGCTGCTTTGTGGTGTATACTTGGAGTTCCC
AGCATCTGGTGGATTGACCTTCAAGTGGACGGAGTGCGCAAAGGGTCTTTGAAACAGCAGCAAGCACGTCTGCCT
CAACCCGGCTCTGTCATCGCCTCGTCCTTCACATCACCTATTGATGCCGTGTACCTGGCGGCTATCTTCGACCCG
ATCTTCACAGCATCCTACCCCAACACTCGCCAGGTCGAGCGCATCTCTCTGTTCCAAGCCATACTGCGAGCCTTC
GCTTCCCCCGCAACGCAACCGGCCCCTGGTGCCCTGATGGTGGATGTCTCAAGCTTGGTCGAGAAGTACCCCAAC
AGACCGATTGTATTGTTCCCAGAGTGTACCACCACCAACGGCCGTGGCATCTTGACCTTGAGCAACTCCCTTCTC
AGCGTACCTCCCAAGACCAAGATCTTCCCCGTTAGTCTGCGCTATACGCCTATGGATATCGTGACCCCCCTCCCT
GGGAGCTATATGAGCTTGCTGTGGACGCTTCTTAGCAAGCCGACCCACTGCATCAGAGTGCGCATCGCGGAGTGC
ATCACAAGAAGCCAAAATGCCATTGATACGGCTCCCTCTCTGGCGACTGCGAAGTCGACCTATAATACGAATTAC
CTGGACACACTGGACCGGGACGGGCAAGAACTGGCATCGTCCAGCGAGAAGGCGCTCCTGGATAATGTGGGCGAG
TCGCTCGCCCGTCTTGGTCGGGTTAAGCGGGTTGGCTTGGGGGTGAAAGAGAAGCAGGAATTTTCTCGAGCTTGG
AGTAAGAGTCGTCGGACATGGTGA
Transcript >Pro_DTO377G3_2|g9329.t1
ATGGAGAGATACTCACAGTTTCGGGATCGAGGCTCGGGAATTGCACCCTTCCTCCCGATCCCCGTTGAACCACTC
GGCCTCCAAACGCCTCTTCGCATTTTCCTTTTCTGCTTCCGCCTCCCGCTATTTATTTTCGTCACTCTTAGCTAT
TTTTTGATCCTACAATGGCTTCCTATCGGATCGCTGGGCAAAAAGGCTGCTTTGTGGTGTATACTTGGAGTTCCC
AGCATCTGGTGGATTGACCTTCAAGTGGACGGAGTGCGCAAAGGGTCTTTGAAACAGCAGCAAGCACGTCTGCCT
CAACCCGGCTCTGTCATCGCCTCGTCCTTCACATCACCTATTGATGCCGTGTACCTGGCGGCTATCTTCGACCCG
ATCTTCACAGCATCCTACCCCAACACTCGCCAGGTCGAGCGCATCTCTCTGTTCCAAGCCATACTGCGAGCCTTC
GCTTCCCCCGCAACGCAACCGGCCCCTGGTGCCCTGATGGTGGATGTCTCAAGCTTGGTCGAGAAGTACCCCAAC
AGACCGATTGTATTGTTCCCAGAGTGTACCACCACCAACGGCCGTGGCATCTTGACCTTGAGCAACTCCCTTCTC
AGCGTACCTCCCAAGACCAAGATCTTCCCCGTTAGTCTGCGCTATACGCCTATGGATATCGTGACCCCCCTCCCT
GGGAGCTATATGAGCTTGCTGTGGACGCTTCTTAGCAAGCCGACCCACTGCATCAGAGTGCGCATCGCGGAGTGC
ATCACAAGAAGCCAAAATGCCATTGATACGGCTCCCTCTCTGGCGACTGCGAAGTCGACCTATAATACGAATTAC
CTGGACACACTGGACCGGGACGGGCAAGAACTGGCATCGTCCAGCGAGAAGGCGCTCCTGGATAATGTGGGCGAG
TCGCTCGCCCGTCTTGGTCGGGTTAAGCGGGTTGGCTTGGGGGTGAAAGAGAAGCAGGAATTTTCTCGAGCTTGG
AGTAAGAGTCGTCGGACATGGTGA
Gene >Pro_DTO377G3_2|g9329.t1
ATGGAGAGATACTCACAGTTTCGGGATCGAGGTAAATTTGCGCTGTGCTAACCAGCCCCCAAGTCCAGTTATACT
GACATCTCTAGGCTCGGGAATTGCACCCTTCCTCCCGATCCCCGTTGAACCACTCGGCCTCCAAACGCCTCTTCG
CATTTTCCTTTTCTGCTTCCGCCTCCCGCTATTTATTTTCGTCACTCTTAGCTATTTTTTGATCCTACAATGGCT
TCCTATCGGATCGCTGGGCAAAAAGGCTGCTTTGTGGTGTATACTTGGAGTTCCCAGCATCTGGTGGATTGACCT
TCAAGTGGACGGAGTGCGCAAAGGGTTCGTGCTGCACCATCGAAACTATAGCCTGTTCTGCTGGTAACTAAAATA
TCCGGCACAGGTCTTTGAAACAGCAGCAAGCACGTCTGCCTCAACCCGGCTCTGTCATCGCCTCGTCCTTCACAT
CACCTATTGATGCCGTGTACCTGGCGGCTATCTTCGACCCGATCTTCACAGCATCCTACCCCAACACTCGCCAGG
TCGAGCGCATCTCTCTGTTCCAAGCCATACTGCGAGCCTTCGCTTCCCCCGCAACGCAACCGGCCCCTGGTGCCC
TGATGGTGGATGTCTCAAGCTTGGTCGAGAAGTACCCCAACAGACCGATTGTATTGTTCCCAGAGTGTACCACCA
CCAACGGCCGTGGCATCTTGACCTTGAGCAACTCCCTTCTCAGCGTACCTCCCAAGACCAAGATCTTCCCCGTTA
GTCTGCGCTATACGCCTATGGATATCGTGACCCCCCTCCCTGGGAGCTATATGAGCTTGCTGTGGACGCTTCTTA
GCAAGCCGACCCACTGCATCAGAGTGCGCATCGCGGAGTGCATCACAAGAAGCCAAAATGCCATTGATACGGCTC
CCTCTCTGGCGACTGCGAAGTCGACCTATAATACGAATTACCTGGACACACTGGACCGGGACGGGCAAGAACTGG
CATCGTCCAGCGAGAAGGCGCTCCTGGATAATGTGGGCGAGTCGCTCGCCCGTCTTGGTCGGGTTAAGCGGGTTG
GCTTGGGGGTGAAAGAGAAGCAGGAATTTTCTCGAGCTTGGAGTAAGAGTCGTCGGACATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail