Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9321.t1
Gene name
Locationscaffold_45:71738..73368
Strand+
Gene length (bp)1630
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01008 IF-2B Initiation factor 2 subunit family 2.7E-20 242 498
PF00293 NUDIX NUDIX domain 3.0E-11 6 132

GO

GO Term Description Terminal node
GO:0044237 cellular metabolic process Yes
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1213.23 616.53 1809.94
5d_25C Five days - 25 degrees Celsius 1810.06 856.08 2764.04
7d_25C Seven days - 25 degrees Celsius 1625.50 762.19 2488.81
10d_25C Ten days - 25 degrees Celsius 1630.43 789.96 2470.90
7d_15C Seven days - 15 degrees Celsius 1846.20 792.17 2900.22
7d_30C Seven days - 30 degrees Celsius 1331.84 625.48 2038.19

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.164348 no
3d_25C 7d_25C 0.338641 no
3d_25C 7d_15C 0.163348 no
3d_25C 7d_30C 0.813328 no
3d_25C 10d_25C 0.328484 no
5d_25C 7d_25C 0.786825 no
5d_25C 7d_15C 0.968710 no
5d_25C 7d_30C 0.342594 no
5d_25C 10d_25C 0.789864 no
7d_25C 7d_15C 0.756533 no
7d_25C 7d_30C 0.577859 no
7d_25C 10d_25C 0.994324 no
7d_15C 7d_30C 0.318308 no
7d_15C 10d_25C 0.750298 no
7d_30C 10d_25C 0.555836 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9321.t1
MKSLKPRSVVSSFICSNAGEPKIAIFRRSDKVSTYQHHLAPISGSIESPESPLAAAWRELREETTLTSRDMELWR
QGKAFTFSDPSVGRQWTIFPFLYRLKDCSEGGRGEAGLQIDWEHEGWQWYSPDAIQDDDKFGGVPHLKESFRRVW
FEVDMNDGASKALITGLKQLKADHQSGSHELTSIALRAYRDVIAQMHEDIDTQWWENARMAAWHLWKNGRESMGA
ATLNAFLGLLADMEVIIHENLDSTVKRERLLALIDQHLDKRKEMPMRIKHSFATYLESKFLSTTRSRPTPSLVIL
TLSSSSTIRDSIIEAFASLPIPNLDLRILESRPLCEGVNMASSILSAFKTRFPSSSDRHLKLTVYTDASAALASK
DVDFILLGADRISDSGSVSNKTGSLPAVLSAKHVCPAAKVLVLSELEKVAEPDAESNRSQEENDPKELVGCWVEY
GIKGLNAIAEGIDADRDNTNYTVEVKNIYFEWVPAELIEAYICEEGTLDATAIQEKAQQVKQKADRYFGQL*
Coding >Pro_DTO377G3_2|g9321.t1
ATGAAGTCCTTGAAGCCAAGATCAGTGGTATCCTCTTTCATCTGCTCAAATGCAGGAGAACCCAAAATTGCCATT
TTTCGGCGAAGTGATAAAGTCAGCACATATCAGCACCACCTCGCTCCCATCTCGGGCAGTATAGAAAGTCCCGAA
AGTCCACTAGCAGCAGCATGGCGGGAGCTGAGAGAGGAGACTACTCTCACCTCACGAGATATGGAGCTTTGGCGA
CAGGGAAAGGCATTCACATTCAGTGATCCCTCTGTCGGTCGACAATGGACCATTTTCCCGTTCCTATACCGACTC
AAAGACTGCAGTGAAGGTGGCCGCGGCGAGGCGGGTCTTCAAATTGACTGGGAGCATGAAGGCTGGCAGTGGTAT
AGTCCCGACGCAATCCAAGACGATGACAAGTTTGGTGGCGTACCACATCTGAAAGAAAGCTTTCGACGAGTCTGG
TTCGAAGTTGACATGAATGATGGCGCTAGCAAGGCACTGATAACTGGCCTGAAACAGCTAAAGGCAGATCATCAG
AGCGGATCGCACGAGCTGACCTCGATTGCGCTGCGGGCCTACCGAGATGTTATTGCGCAGATGCACGAGGATATT
GACACGCAGTGGTGGGAGAATGCTCGCATGGCTGCATGGCATCTGTGGAAAAATGGACGAGAAAGCATGGGGGCA
GCCACCTTGAATGCATTTCTCGGATTGCTGGCCGACATGGAAGTTATCATACATGAGAATCTCGACTCCACGGTC
AAACGGGAACGCTTGTTGGCTTTGATCGACCAGCATTTGGACAAGCGCAAGGAGATGCCCATGCGCATCAAGCAC
TCCTTTGCGACCTATCTTGAATCCAAGTTCTTGTCTACAACACGCTCCAGGCCTACGCCCTCTCTCGTTATTCTC
ACCCTCTCGTCGAGCTCTACCATCCGGGACAGCATCATAGAAGCCTTCGCGTCTCTTCCAATTCCTAATCTGGAT
CTTCGCATACTGGAATCTCGTCCGCTTTGCGAGGGTGTCAATATGGCATCTTCCATCCTCTCTGCCTTCAAAACA
AGATTTCCCTCATCTTCCGATCGGCATCTCAAATTAACTGTGTACACCGATGCATCCGCCGCTCTTGCCAGCAAG
GACGTAGATTTCATCCTGCTAGGGGCAGATCGGATCTCGGATTCAGGCTCAGTGAGCAATAAAACTGGATCTTTG
CCAGCTGTTCTGAGTGCCAAGCATGTCTGTCCTGCCGCCAAAGTCTTGGTTCTCAGTGAGCTGGAGAAAGTGGCC
GAGCCTGACGCCGAGAGCAATCGGAGCCAGGAAGAGAATGATCCAAAAGAGCTGGTGGGCTGCTGGGTGGAATAT
GGCATCAAAGGACTTAATGCTATTGCTGAGGGAATTGATGCTGATCGAGATAACACAAACTACACAGTTGAAGTT
AAGAATATTTACTTCGAATGGGTTCCGGCTGAACTCATAGAAGCGTATATCTGTGAAGAGGGGACTTTGGACGCC
ACTGCTATTCAAGAGAAGGCTCAACAAGTAAAGCAAAAGGCGGACAGATACTTTGGTCAACTTTGA
Transcript >Pro_DTO377G3_2|g9321.t1
ATGAAGTCCTTGAAGCCAAGATCAGTGGTATCCTCTTTCATCTGCTCAAATGCAGGAGAACCCAAAATTGCCATT
TTTCGGCGAAGTGATAAAGTCAGCACATATCAGCACCACCTCGCTCCCATCTCGGGCAGTATAGAAAGTCCCGAA
AGTCCACTAGCAGCAGCATGGCGGGAGCTGAGAGAGGAGACTACTCTCACCTCACGAGATATGGAGCTTTGGCGA
CAGGGAAAGGCATTCACATTCAGTGATCCCTCTGTCGGTCGACAATGGACCATTTTCCCGTTCCTATACCGACTC
AAAGACTGCAGTGAAGGTGGCCGCGGCGAGGCGGGTCTTCAAATTGACTGGGAGCATGAAGGCTGGCAGTGGTAT
AGTCCCGACGCAATCCAAGACGATGACAAGTTTGGTGGCGTACCACATCTGAAAGAAAGCTTTCGACGAGTCTGG
TTCGAAGTTGACATGAATGATGGCGCTAGCAAGGCACTGATAACTGGCCTGAAACAGCTAAAGGCAGATCATCAG
AGCGGATCGCACGAGCTGACCTCGATTGCGCTGCGGGCCTACCGAGATGTTATTGCGCAGATGCACGAGGATATT
GACACGCAGTGGTGGGAGAATGCTCGCATGGCTGCATGGCATCTGTGGAAAAATGGACGAGAAAGCATGGGGGCA
GCCACCTTGAATGCATTTCTCGGATTGCTGGCCGACATGGAAGTTATCATACATGAGAATCTCGACTCCACGGTC
AAACGGGAACGCTTGTTGGCTTTGATCGACCAGCATTTGGACAAGCGCAAGGAGATGCCCATGCGCATCAAGCAC
TCCTTTGCGACCTATCTTGAATCCAAGTTCTTGTCTACAACACGCTCCAGGCCTACGCCCTCTCTCGTTATTCTC
ACCCTCTCGTCGAGCTCTACCATCCGGGACAGCATCATAGAAGCCTTCGCGTCTCTTCCAATTCCTAATCTGGAT
CTTCGCATACTGGAATCTCGTCCGCTTTGCGAGGGTGTCAATATGGCATCTTCCATCCTCTCTGCCTTCAAAACA
AGATTTCCCTCATCTTCCGATCGGCATCTCAAATTAACTGTGTACACCGATGCATCCGCCGCTCTTGCCAGCAAG
GACGTAGATTTCATCCTGCTAGGGGCAGATCGGATCTCGGATTCAGGCTCAGTGAGCAATAAAACTGGATCTTTG
CCAGCTGTTCTGAGTGCCAAGCATGTCTGTCCTGCCGCCAAAGTCTTGGTTCTCAGTGAGCTGGAGAAAGTGGCC
GAGCCTGACGCCGAGAGCAATCGGAGCCAGGAAGAGAATGATCCAAAAGAGCTGGTGGGCTGCTGGGTGGAATAT
GGCATCAAAGGACTTAATGCTATTGCTGAGGGAATTGATGCTGATCGAGATAACACAAACTACACAGTTGAAGTT
AAGAATATTTACTTCGAATGGGTTCCGGCTGAACTCATAGAAGCGTATATCTGTGAAGAGGGGACTTTGGACGCC
ACTGCTATTCAAGAGAAGGCTCAACAAGTAAAGCAAAAGGCGGACAGATACTTTGGTCAACTTTGA
Gene >Pro_DTO377G3_2|g9321.t1
ATGAAGTCCTTGAAGCCAAGATCAGTGGTATCCTCTTTCATCTGCTCAAATGCAGGAGAACCCAAAATTGCCATT
TTTCGGCGAAGTGATAAAGTCAGCACATATCAGTATGTATCCTCAAGTCCCGCTTTACTATAAATTACTGTAGTC
CAGATGAACTGATTTCTCTAGGCACCACCTCGCTCCCATCTCGGGCAGTATAGAAAGTCCCGAAAGTCCACTAGC
AGCAGCATGGCGGGAGCTGAGAGAGGAGACTACTCTCACCTCACGAGATATGGAGCTTTGGCGACAGGGAAAGGC
ATTCACATTCAGTGATCCCTCTGTCGGTCGACAATGGACCATTTTCCCGTTCCTATACCGACTCAAAGACTGCAG
TGAAGGTGGCCGCGGCGAGGCGGGTCTTCAAATTGACTGGGAGCATGAAGGCTGGCAGTGGTATAGTCCCGACGC
AATCCAAGACGATGACAAGTTTGGTGGCGTACCACATCTGAAAGAAAGCTTTCGACGAGTCTGGTTCGAAGTTGA
CATGAATGATGGCGCTAGCAAGGCACTGATAACTGGCCTGAAACAGCTAAAGGCAGATCATCAGAGCGGATCGCA
CGAGCTGACCTCGATTGCGCTGCGGGCCTACCGAGATGTTATTGCGCAGATGCACGAGGATATTGACACGCAGTG
GTGGGAGAATGCTCGCATGGCTGCATGGCATCTGTGGAAAAATGGACGAGAAAGCATGGGGGCAGCCACCTTGAA
TGCATTTCTCGGATTGCTGGCCGACATGGAAGTTATCATACATGAGAATCTCGACTCCACGGTCAAACGGGAACG
CTTGTTGGCTTTGATCGACCAGCATTTGGACAAGCGCAAGGAGATGCCCATGCGCATCAAGCACTCCTTTGCGAC
CTATCTTGAATCCAAGTTCTTGTCTACAACACGCTCCAGGCCTACGCCCTCTCTCGTTATTCTCACCCTCTCGTC
GAGCTCTACCATCCGGGACAGCATCATAGAAGCCTTCGCGTCTCTTCCAATTCCTAATCTGGATCTTCGCATACT
GGAATCTCGTCCGCTTTGCGAGGGTGTCAATATGGCATCTTCCATCCTCTCTGCCTTCAAAACAAGATTTCCCTC
ATCTTCCGATCGGCATCTCAAATTAACTGTGTACACCGATGCATCCGCCGCTCTTGCCAGCAAGGACGTAGATTT
CATCCTGCTAGGGGCAGATCGGATCTCGGATTCAGGCTCAGTGAGCAATAAAACTGGATCTTTGCCAGCTGTTCT
GAGTGCCAAGCATGTCTGTCCTGCCGCCAAAGTCTTGGTTCTCAGTGAGCTGGAGAAAGTGGCCGAGCCTGACGC
CGAGAGCAATCGGAGCCAGGAAGAGAATGATCCAAAAGAGCTGGTGGGCTGCTGGGTGGAATATGGCATCAAAGG
ACTTAATGCTATTGCTGAGGGAATTGATGCTGATCGAGATAACACAAACTACACAGTTGAAGTTAAGAATATTTA
CTTCGAATGGGTTCCGGCTGAACTCATAGAAGCGTATATCTGTGAAGAGGGGACTTTGGACGCCACTGCTATTCA
AGAGAAGGCTCAACAAGTAAAGCAAAAGGCGGACAGATACTTTGGTCAACTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail