Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9312.t1
Gene name
Locationscaffold_45:55400..56771
Strand-
Gene length (bp)1371
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 1.7E-17 178 374

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 23.69 11.89 35.49
5d_25C Five days - 25 degrees Celsius 4.24 0.85 7.64
7d_25C Seven days - 25 degrees Celsius 14.95 6.39 23.51
10d_25C Ten days - 25 degrees Celsius 9.43 2.92 15.94
7d_15C Seven days - 15 degrees Celsius 3.82 0.69 6.96
7d_30C Seven days - 30 degrees Celsius 14.96 6.57 23.35

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.134199 no
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.133708 no
3d_25C 10d_25C 0.006742 yes
5d_25C 7d_25C 0.002297 yes
5d_25C 7d_15C 0.880723 no
5d_25C 7d_30C 0.002297 yes
5d_25C 10d_25C 0.063693 no
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.998423 no
7d_25C 10d_25C 0.212099 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.029770 yes
7d_30C 10d_25C 0.210858 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9312.t1
MTITTPFQCLVSRLGQMALKEALEPSPQAHFELLRVIDELRSAVETPTETVLRLIYQPPQNAALRVVIDLGIFAM
LVEKRHRGTGLSAAQLAEYTGAERDLIVRLMRVMASLGLCVTPTPELYVANEKTVALTQPIGRDGIPCIYDLTFP
TLSKLPEYLRSHGYANPQDYTQSPMQWAVGQSQFEWLSSHAQQQELFNSYMASRREGRPMWYDIYPVGRLFGHAV
PYKDTVFLVDIGGNQGHDLGKFRREYGHLPGRMVLQDLPSVIEGVEAESAGIEVMGYNFMDPQPVKGARAYYFRS
IFHDWDDHISRKILRNTVTAMAPDYSRILIVDFVLPDTDTPLMQASLDIQMMSIGAGVERSERQWRDLLHSAGLE
ITGIWNQSPAMESVIEAVPMLK*
Coding >Pro_DTO377G3_2|g9312.t1
ATGACGATCACCACACCCTTTCAATGTTTGGTCAGCCGTCTCGGCCAAATGGCTCTGAAAGAAGCCTTGGAGCCA
TCGCCACAAGCCCACTTTGAGCTATTACGAGTGATCGACGAGCTGAGGTCTGCAGTGGAAACGCCGACGGAGACC
GTGTTGCGTCTGATCTACCAGCCTCCTCAAAATGCTGCATTGCGCGTTGTCATTGATTTGGGAATTTTCGCCATG
CTTGTGGAGAAGCGGCACAGAGGAACGGGGCTTTCAGCCGCTCAGCTGGCAGAATACACGGGCGCTGAGCGTGAT
TTAATTGTCCGACTGATGCGTGTCATGGCTTCTCTTGGGCTGTGCGTCACACCGACTCCCGAGCTCTATGTTGCC
AATGAGAAGACGGTGGCACTCACTCAGCCGATTGGGAGAGATGGAATCCCATGCATATATGATCTTACCTTTCCA
ACCCTGAGCAAACTTCCGGAGTATCTGCGCTCCCACGGCTATGCCAATCCCCAGGATTATACTCAGTCGCCTATG
CAATGGGCCGTTGGTCAGAGTCAGTTTGAGTGGCTTTCGAGTCATGCCCAGCAGCAGGAGCTCTTCAACTCGTAC
ATGGCTAGTCGTCGCGAGGGTAGACCGATGTGGTACGATATATACCCCGTCGGACGACTGTTTGGCCATGCCGTG
CCATACAAAGATACCGTCTTCCTAGTAGACATTGGTGGCAACCAGGGGCATGATCTGGGCAAGTTCCGCCGGGAA
TATGGCCATCTGCCTGGCAGAATGGTACTGCAGGATTTACCAAGCGTGATCGAAGGGGTCGAGGCAGAGAGTGCA
GGAATCGAGGTGATGGGATACAATTTCATGGATCCTCAACCGGTCAAAGGTGCCCGTGCGTACTACTTTCGCTCT
ATCTTCCACGACTGGGATGACCATATCAGTCGCAAGATCCTCCGCAATACGGTGACAGCAATGGCGCCGGACTAT
TCTCGGATTCTCATTGTGGATTTCGTCCTGCCAGACACCGATACGCCGCTGATGCAGGCCTCCCTAGATATTCAG
ATGATGAGTATAGGAGCTGGTGTCGAGCGGTCAGAGCGACAGTGGAGAGATCTCTTGCATAGTGCCGGCCTGGAA
ATCACGGGGATTTGGAACCAGAGTCCGGCGATGGAATCGGTGATTGAAGCGGTTCCAATGTTAAAATAG
Transcript >Pro_DTO377G3_2|g9312.t1
ATGACGATCACCACACCCTTTCAATGTTTGGTCAGCCGTCTCGGCCAAATGGCTCTGAAAGAAGCCTTGGAGCCA
TCGCCACAAGCCCACTTTGAGCTATTACGAGTGATCGACGAGCTGAGGTCTGCAGTGGAAACGCCGACGGAGACC
GTGTTGCGTCTGATCTACCAGCCTCCTCAAAATGCTGCATTGCGCGTTGTCATTGATTTGGGAATTTTCGCCATG
CTTGTGGAGAAGCGGCACAGAGGAACGGGGCTTTCAGCCGCTCAGCTGGCAGAATACACGGGCGCTGAGCGTGAT
TTAATTGTCCGACTGATGCGTGTCATGGCTTCTCTTGGGCTGTGCGTCACACCGACTCCCGAGCTCTATGTTGCC
AATGAGAAGACGGTGGCACTCACTCAGCCGATTGGGAGAGATGGAATCCCATGCATATATGATCTTACCTTTCCA
ACCCTGAGCAAACTTCCGGAGTATCTGCGCTCCCACGGCTATGCCAATCCCCAGGATTATACTCAGTCGCCTATG
CAATGGGCCGTTGGTCAGAGTCAGTTTGAGTGGCTTTCGAGTCATGCCCAGCAGCAGGAGCTCTTCAACTCGTAC
ATGGCTAGTCGTCGCGAGGGTAGACCGATGTGGTACGATATATACCCCGTCGGACGACTGTTTGGCCATGCCGTG
CCATACAAAGATACCGTCTTCCTAGTAGACATTGGTGGCAACCAGGGGCATGATCTGGGCAAGTTCCGCCGGGAA
TATGGCCATCTGCCTGGCAGAATGGTACTGCAGGATTTACCAAGCGTGATCGAAGGGGTCGAGGCAGAGAGTGCA
GGAATCGAGGTGATGGGATACAATTTCATGGATCCTCAACCGGTCAAAGGTGCCCGTGCGTACTACTTTCGCTCT
ATCTTCCACGACTGGGATGACCATATCAGTCGCAAGATCCTCCGCAATACGGTGACAGCAATGGCGCCGGACTAT
TCTCGGATTCTCATTGTGGATTTCGTCCTGCCAGACACCGATACGCCGCTGATGCAGGCCTCCCTAGATATTCAG
ATGATGAGTATAGGAGCTGGTGTCGAGCGGTCAGAGCGACAGTGGAGAGATCTCTTGCATAGTGCCGGCCTGGAA
ATCACGGGGATTTGGAACCAGAGTCCGGCGATGGAATCGGTGATTGAAGCGGTTCCAATGTTAAAATAG
Gene >Pro_DTO377G3_2|g9312.t1
ATGACGATCACCACACCCTTTCAATGTTTGGTCAGCCGTCTCGGCCAAATGGCTCTGAAAGAAGCCTTGGAGCCA
TCGCCACAAGCCCACTTTGAGCTATTACGAGTGATCGACGAGCTGAGGTCTGCAGTGGAAACGCCGACGGAGACC
GTGTTGCGTCTGATCTACCAGGTGAGGCGTTCCACGGACCAAAACTGACTTCTCATTCTGACTGGACTATAGCCT
CCTCAAAATGCTGCATTGCGCGTTGTCATTGATTTGGGAATTTTCGCCATGCTTGTGGAGAAGCGGCACAGAGGA
ACGGGGCTTTCAGCCGCTCAGCTGGCAGAATACACGGGCGCTGAGCGTGATTTAATTGGTACTTTTTCCTGCAAT
ATCATTAGTTCGTCACACATTGTGATTCGGCTAACTCCGTGAATTAGTCCGACTGATGCGTGTCATGGCTTCTCT
TGGGCTGTGCGTCACACCGACTCCCGAGCTCTATGTTGCCAATGAGAAGACGGTGGCACTCACTCAGCCGATTGG
GAGAGATGGAATCCCATGCATGTATGTGATGTGGCTTGGTGGCTTGCGTCTCTTCGCGCCGTTACTCACTGACCC
TTGTTTAGATATGATCTTACCTTTCCAACCCTGAGCAAACTTCCGGAGTATCTGCGCTCCCACGGCTATGCCAAT
CCCCAGGATTATACTCAGTCGCCTATGCAATGGGCCGTTGGTCAGAGTCAGTTTGAGTGGCTTTCGAGTCATGCC
CAGCAGCAGGAGCTCTTCAACTCGTACATGGCTAGTCGTCGCGAGGGTAGACCGATGTGGTACGATATATACCCC
GTCGGACGACTGTTTGGCCATGCCGTGCCATACAAAGATACCGTCTTCCTAGTAGACATTGGTGGCAACCAGGGG
CATGATCTGGGCAAGTTCCGCCGGGAATATGGCCATCTGCCTGGCAGAATGGTACTGCAGGATTTACCAAGCGTG
ATCGAAGGGGTCGAGGCAGAGAGTGCAGGAATCGAGGTGATGGGATACAATTTCATGGATCCTCAACCGGTCAAA
GGTGCCCGTGCGTACTACTTTCGCTCTATCTTCCACGACTGGGATGACCATATCAGTCGCAAGATCCTCCGCAAT
ACGGTGACAGCAATGGCGCCGGACTATTCTCGGATTCTCATTGTGGATTTCGTCCTGCCAGACACCGATACGCCG
CTGATGCAGGCCTCCCTAGATATTCAGATGATGAGTATAGGAGCTGGTGTCGAGCGGTCAGAGCGACAGTGGAGA
GATCTCTTGCATAGTGCCGGCCTGGAAATCACGGGGATTTGGAACCAGAGTCCGGCGATGGAATCGGTGATTGAA
GCGGTTCCAATGTTAAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail