Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9296.t1
Gene name
Locationscaffold_45:14821..16394
Strand+
Gene length (bp)1573
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76 4.9E-144 34 398

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 431 453 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1.71 0.20 3.23
5d_25C Five days - 25 degrees Celsius 0.59 0.00 1.27
7d_25C Seven days - 25 degrees Celsius 0.39 0.00 0.88
10d_25C Ten days - 25 degrees Celsius 0.43 0.00 0.99
7d_15C Seven days - 15 degrees Celsius 1.74 0.25 3.23
7d_30C Seven days - 30 degrees Celsius 0.48 0.00 1.04

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.088157 no
3d_25C 7d_25C 0.030863 yes
3d_25C 7d_15C 0.985311 no
3d_25C 7d_30C 0.040199 yes
3d_25C 10d_25C 0.048261 yes
5d_25C 7d_25C 1.000000 no
5d_25C 7d_15C 0.081084 no
5d_25C 7d_30C 1.000000 no
5d_25C 10d_25C 1.000000 no
7d_25C 7d_15C 0.023923 yes
7d_25C 7d_30C 1.000000 no
7d_25C 10d_25C 1.000000 no
7d_15C 7d_30C 0.037576 yes
7d_15C 10d_25C 0.042614 yes
7d_30C 10d_25C 1.000000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9296.t1
MHFLGVSPFEGAVAALLLSGVARAIDLDISDEQSIKDAASTSTYAMMKYYYGNETGQIPGAFPDKWWEGAPLFMA
LLEYWHFTGDTTYNEELSVGLQWQSGTDGDYMPSNYSSYLGNDDQMFWGLAAMTAAEFSFPDRSTGFSWLSLAQG
VFNTQIKRWDTTSCGGGLRWQIWPYQSGYTMKNSISNGGLFQLSARLARYTGDAIYLQWANKIWEWSVSSPLLSN
TTWNVADSTDVSNDCATQGNAQWTYNYGTYLMGAAYMYNYTNGTTQAQWLTAVNGLLNATIENFFLTGGVIEDYY
CEPSETCNNNEVLFKGLTSTWLALTALLVPSTFDTILAKLQTSAKAAAASCTGHSNGTCGVRWYKSTWDGWMGME
EEISVTKVFTANLINFNKTSPVTSTTGGNSTSNPTAGESDSDASSTTTTVTTGDRAGAGILTAVFVAGWIGLMAF
MMLGG*
Coding >Pro_DTO377G3_2|g9296.t1
ATGCACTTTCTCGGGGTGTCTCCCTTTGAAGGAGCTGTCGCTGCACTACTCCTTTCCGGCGTAGCACGCGCAATC
GATTTGGATATTAGCGATGAACAATCGATCAAAGATGCCGCGAGTACCTCCACTTACGCTATGATGAAATATTAT
TACGGCAACGAGACCGGTCAAATTCCTGGAGCCTTTCCAGACAAATGGTGGGAAGGAGCTCCACTTTTTATGGCC
CTGTTAGAGTACTGGCATTTTACTGGCGACACGACATACAACGAGGAACTAAGTGTTGGATTGCAATGGCAATCA
GGTACGGATGGGGACTATATGCCAAGCAACTACAGTTCTTACCTGGGGAACGATGATCAAATGTTCTGGGGTCTA
GCGGCTATGACGGCCGCTGAGTTCTCATTTCCGGACCGATCGACTGGGTTCTCTTGGCTCTCTCTAGCTCAGGGT
GTCTTCAATACCCAGATCAAAAGATGGGATACAACCTCTTGTGGCGGTGGTCTACGGTGGCAGATTTGGCCCTAC
CAATCTGGATATACAATGAAAAATTCTATCTCCAATGGGGGGTTATTTCAGTTATCTGCACGTCTAGCCCGCTAC
ACCGGAGATGCAATCTATCTGCAGTGGGCTAACAAGATCTGGGAATGGTCTGTCTCGTCACCTCTGCTAAGCAAC
ACAACATGGAACGTTGCCGATTCCACCGATGTTAGTAATGATTGTGCGACCCAAGGAAACGCCCAATGGACATAT
AACTACGGCACGTACCTGATGGGGGCGGCGTATATGTACAACTATACAAACGGTACTACCCAAGCTCAATGGCTG
ACAGCAGTAAATGGCCTACTGAACGCGACAATTGAGAACTTTTTCCTCACGGGTGGGGTTATCGAAGACTATTAC
TGCGAGCCTTCAGAAACCTGCAATAATAACGAGGTCCTTTTCAAAGGACTGACTTCCACATGGTTGGCATTGACT
GCTCTCCTTGTTCCATCGACATTTGACACCATTCTCGCGAAGCTCCAAACATCGGCCAAGGCAGCCGCTGCATCC
TGCACGGGCCACAGCAATGGCACTTGTGGTGTCCGGTGGTATAAGTCTACATGGGACGGGTGGATGGGAATGGAG
GAAGAGATCAGTGTGACAAAAGTCTTCACGGCAAATCTGATCAACTTTAACAAGACTTCTCCGGTGACCTCGACC
ACTGGCGGAAACAGTACCAGCAATCCAACGGCAGGTGAAAGTGACAGTGATGCTTCCAGTACAACGACTACAGTG
ACAACCGGTGACAGGGCGGGCGCTGGCATCCTGACCGCTGTTTTTGTGGCTGGATGGATTGGACTCATGGCTTTC
ATGATGCTTGGTGGTTGA
Transcript >Pro_DTO377G3_2|g9296.t1
ATGCACTTTCTCGGGGTGTCTCCCTTTGAAGGAGCTGTCGCTGCACTACTCCTTTCCGGCGTAGCACGCGCAATC
GATTTGGATATTAGCGATGAACAATCGATCAAAGATGCCGCGAGTACCTCCACTTACGCTATGATGAAATATTAT
TACGGCAACGAGACCGGTCAAATTCCTGGAGCCTTTCCAGACAAATGGTGGGAAGGAGCTCCACTTTTTATGGCC
CTGTTAGAGTACTGGCATTTTACTGGCGACACGACATACAACGAGGAACTAAGTGTTGGATTGCAATGGCAATCA
GGTACGGATGGGGACTATATGCCAAGCAACTACAGTTCTTACCTGGGGAACGATGATCAAATGTTCTGGGGTCTA
GCGGCTATGACGGCCGCTGAGTTCTCATTTCCGGACCGATCGACTGGGTTCTCTTGGCTCTCTCTAGCTCAGGGT
GTCTTCAATACCCAGATCAAAAGATGGGATACAACCTCTTGTGGCGGTGGTCTACGGTGGCAGATTTGGCCCTAC
CAATCTGGATATACAATGAAAAATTCTATCTCCAATGGGGGGTTATTTCAGTTATCTGCACGTCTAGCCCGCTAC
ACCGGAGATGCAATCTATCTGCAGTGGGCTAACAAGATCTGGGAATGGTCTGTCTCGTCACCTCTGCTAAGCAAC
ACAACATGGAACGTTGCCGATTCCACCGATGTTAGTAATGATTGTGCGACCCAAGGAAACGCCCAATGGACATAT
AACTACGGCACGTACCTGATGGGGGCGGCGTATATGTACAACTATACAAACGGTACTACCCAAGCTCAATGGCTG
ACAGCAGTAAATGGCCTACTGAACGCGACAATTGAGAACTTTTTCCTCACGGGTGGGGTTATCGAAGACTATTAC
TGCGAGCCTTCAGAAACCTGCAATAATAACGAGGTCCTTTTCAAAGGACTGACTTCCACATGGTTGGCATTGACT
GCTCTCCTTGTTCCATCGACATTTGACACCATTCTCGCGAAGCTCCAAACATCGGCCAAGGCAGCCGCTGCATCC
TGCACGGGCCACAGCAATGGCACTTGTGGTGTCCGGTGGTATAAGTCTACATGGGACGGGTGGATGGGAATGGAG
GAAGAGATCAGTGTGACAAAAGTCTTCACGGCAAATCTGATCAACTTTAACAAGACTTCTCCGGTGACCTCGACC
ACTGGCGGAAACAGTACCAGCAATCCAACGGCAGGTGAAAGTGACAGTGATGCTTCCAGTACAACGACTACAGTG
ACAACCGGTGACAGGGCGGGCGCTGGCATCCTGACCGCTGTTTTTGTGGCTGGATGGATTGGACTCATGGCTTTC
ATGATGCTTGGTGGTTGA
Gene >Pro_DTO377G3_2|g9296.t1
ATGCACTTTCTCGGGGTGTCTCCCTTTGAAGGAGCTGTCGCTGCACTACTCCTTTCCGGCGTAGCACGCGCAATC
GATTTGGATATTAGCGATGAACGTACGTGGTGGAGTTGAGATTCCGCGCCTCCCCGGCCCATGTCAATTACCAGA
GAAGTTAACTTTTGATCTCATAACAGAATCGATCAAAGATGCCGCGAGTACCTCCACTTACGCTATGATGAAATA
TTATTACGGCAACGAGACCGGTCAAATTCCTGGAGCCTTTCCAGACAAATGGTGGGAAGGAGCTCCACTTTTTAT
GGCCCTGTTAGAGTACTGGCATTTTACTGGCGACACGACATACAACGAGGAACTAAGTGTTGGATTGCAATGGCA
ATCAGGTACGGATGGGGACTATATGCCAAGCAACTACAGTTCTTACCTGGTGAGCATCTTCAGAGTCTCAAAAGG
CAACAATCTCTAATGCCGGGTATCTACCAGGGGAACGATGATCAAATGTTCTGGGGTCTAGCGGCTATGACGGCC
GCTGAGTTCTCATTTCCGGACCGATCGACTGGGTTCTCTTGGCTCTCTCTAGCTCAGGGTGTCTTCAATACCCAG
ATCAAAAGATGGGATACAACCTCTTGTGGCGGTGGTCTACGGTGGCAGATTTGGCCCTACCAATCTGGATATACA
ATGAAAAATTCTATCTCCAATGGGGGGTTATTTCAGTTATCTGCACGTCTAGCCCGCTACACCGGAGATGCAATC
TATCTGCAGTGGGCTAACAAGATCTGGGAATGGTCTGTCTCGTCACCTCTGCTAAGCAACACAACATGGAACGTT
GCCGATTCCACCGATGTTAGTAATGATTGTGCGACCCAAGGAAACGCCCAATGGACATATAACTACGGCACGTAC
CTGATGGGGGCGGCGTATATGTACAACTATGTGAGAAATGCCCTTTTCAAATTCATGTTGGCTTTGTTCAAGTAC
GTGTACTAACCTCTACTGCCTACAGACAAACGGTACTACCCAAGCTCAATGGCTGACAGCAGTAAATGGCCTACT
GAACGCGACAATTGAGAACTTTTTCCTCACGGGTGGGGTTATCGAAGACTATTACTGCGAGCCTTCAGAAACCTG
CAATAATAACGAGGTCCTTTTCAAAGGACTGACTTCCACATGGTTGGCATTGACTGCTCTCCTTGTTCCATCGAC
ATTTGACACCATTCTCGCGAAGCTCCAAACATCGGCCAAGGCAGCCGCTGCATCCTGCACGGGCCACAGCAATGG
CACTTGTGGTGTCCGGTGGTATAAGTCTACATGGGACGGGTGGATGGGAATGGAGGAAGAGATCAGTGTGACAAA
AGTCTTCACGGCAAATCTGATCAACTTTAACAAGACTTCTCCGGTGACCTCGACCACTGGCGGAAACAGTACCAG
CAATCCAACGGCAGGTGAAAGTGACAGTGATGCTTCCAGTACAACGACTACAGTGACAACCGGTGACAGGGCGGG
CGCTGGCATCCTGACCGCTGTTTTTGTGGCTGGATGGATTGGACTCATGGCTTTCATGATGCTTGGTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail