Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9295.t1
Gene name
Locationscaffold_45:12737..14392
Strand+
Gene length (bp)1655
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.5E-50 76 476

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 103 125 22
3 135 152 17
4 194 216 22
5 226 245 19
6 310 332 22
7 342 364 22
8 399 421 22
9 431 453 22
10 460 482 22
11 492 514 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 6.38 2.33 10.43
5d_25C Five days - 25 degrees Celsius 4.15 1.28 7.02
7d_25C Seven days - 25 degrees Celsius 2.90 0.63 5.17
10d_25C Ten days - 25 degrees Celsius 2.13 0.46 3.81
7d_15C Seven days - 15 degrees Celsius 5.06 1.72 8.41
7d_30C Seven days - 30 degrees Celsius 5.47 1.82 9.11

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.277085 no
3d_25C 7d_25C 0.050137 no
3d_25C 7d_15C 0.604237 no
3d_25C 7d_30C 0.753599 no
3d_25C 10d_25C 0.003197 yes
5d_25C 7d_25C 0.446078 no
5d_25C 7d_15C 0.671313 no
5d_25C 7d_30C 0.537227 no
5d_25C 10d_25C 0.108929 no
7d_25C 7d_15C 0.180075 no
7d_25C 7d_30C 0.131752 no
7d_25C 10d_25C 0.566477 no
7d_15C 7d_30C 0.887661 no
7d_15C 10d_25C 0.029318 yes
7d_30C 10d_25C 0.017485 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9295.t1
MQPAQSDSCATGPRPSPLCEVGHVINGEEDPHTLNPNHSKKPEVDQKIQSIGDELVPLYCVLPNGEKTFVIMAGS
FAALFSPLSSSIYLPALPSLASDMNVSVSLINLTITTYLIFQGLAPSFIGSFSDNYGRRPAYIIAFAIYLGANIG
LALQDNFTALMILRCMQSSGSSGTIALGSAVVADLSTRAERGKYIGYAGIGLALGPTLGPVIGGLLDHFLGWRSI
FWFLVILSAVCLVVILIVLPETCRAVVGNGSVPPASWNRPLWTLFVRTSRFDDNQGTADHSTVHRLKKRPNPITA
LLIATQKEMGLVLLYGSFLYAGYMAVISTLSTQLASRFGFNSIEIGLCYLPMGIGSISSRWVVGRVMDWNFRREA
QLQGMIIHKNRQQDIEKFNVERARLAITLPLIYMASLCILAYGWVMQYRTSLAGPLVMLFFTGLTTTSAFNTLST
LVVDINHQSAATAAAANNLFRCLLGAGATAIASPLIKCIGIGWTGTFIAGLWVLGSPALWVVFYRGYRWRSEHKQ
DKLTNQTHA*
Coding >Pro_DTO377G3_2|g9295.t1
ATGCAGCCTGCGCAATCGGATTCTTGTGCAACCGGCCCGCGTCCATCGCCCTTGTGTGAGGTTGGACATGTGATC
AATGGAGAGGAGGACCCTCACACCCTGAATCCAAATCATTCCAAAAAACCAGAAGTTGATCAGAAAATTCAATCG
ATCGGCGATGAACTGGTGCCTCTTTACTGTGTCCTGCCAAATGGCGAGAAGACTTTCGTTATTATGGCGGGATCT
TTTGCAGCCCTTTTTTCACCTCTCTCCAGCAGTATATATCTACCGGCACTCCCATCTTTGGCTAGCGACATGAAT
GTTTCTGTCTCCCTGATCAATTTGACTATCACCACATACTTGATATTCCAAGGACTCGCACCTTCTTTCATTGGC
AGCTTTTCTGATAACTATGGACGCCGTCCGGCATATATCATCGCTTTTGCCATTTATCTTGGAGCTAATATTGGC
CTCGCTTTGCAAGACAACTTCACGGCACTGATGATTCTGCGCTGTATGCAGTCCTCGGGCAGCAGTGGAACTATT
GCATTAGGAAGCGCTGTTGTAGCCGATCTCTCGACCCGCGCCGAGCGTGGGAAATACATTGGATACGCTGGAATT
GGACTTGCACTAGGACCGACCCTTGGCCCCGTTATCGGTGGGCTGTTGGACCATTTCCTCGGGTGGCGATCGATA
TTTTGGTTCCTGGTTATTTTGTCGGCTGTTTGCTTGGTGGTGATCCTTATCGTTCTCCCTGAGACGTGTCGAGCT
GTTGTGGGCAATGGGTCGGTGCCGCCAGCCTCGTGGAACCGCCCACTGTGGACATTGTTCGTACGAACATCACGA
TTCGATGACAACCAAGGGACTGCCGATCACTCCACCGTCCACCGATTGAAGAAGCGCCCAAATCCAATTACAGCG
CTCTTGATAGCCACACAAAAAGAGATGGGGTTGGTTTTATTGTACGGATCCTTCTTATACGCAGGGTACATGGCC
GTTATTAGCACTTTGTCGACCCAGTTGGCGAGTCGATTTGGATTCAACTCGATTGAAATTGGATTGTGCTATCTT
CCGATGGGCATCGGAAGCATAAGCTCCCGCTGGGTAGTTGGCCGAGTCATGGACTGGAACTTTCGCCGCGAGGCA
CAGTTGCAGGGAATGATCATTCACAAAAACCGACAGCAAGATATTGAAAAGTTCAATGTCGAACGAGCACGCTTG
GCGATCACTCTTCCACTGATCTATATGGCTAGCCTTTGTATTTTAGCTTACGGTTGGGTGATGCAGTATCGCACT
TCGCTGGCCGGCCCCCTTGTGATGTTGTTCTTCACCGGTCTTACAACCACAAGTGCATTCAACACCTTGAGTACT
TTGGTTGTAGATATCAATCATCAAAGCGCCGCCACTGCTGCGGCAGCAAATAATCTATTTCGCTGTCTATTGGGT
GCGGGGGCCACGGCTATTGCGTCGCCTCTAATCAAATGCATCGGCATTGGATGGACAGGTACATTCATCGCTGGT
CTTTGGGTGTTAGGCAGTCCTGCTCTATGGGTTGTTTTCTACCGAGGGTACCGGTGGAGGAGCGAGCACAAACAG
GATAAACTCACCAATCAGACGCACGCTTGA
Transcript >Pro_DTO377G3_2|g9295.t1
ATGCAGCCTGCGCAATCGGATTCTTGTGCAACCGGCCCGCGTCCATCGCCCTTGTGTGAGGTTGGACATGTGATC
AATGGAGAGGAGGACCCTCACACCCTGAATCCAAATCATTCCAAAAAACCAGAAGTTGATCAGAAAATTCAATCG
ATCGGCGATGAACTGGTGCCTCTTTACTGTGTCCTGCCAAATGGCGAGAAGACTTTCGTTATTATGGCGGGATCT
TTTGCAGCCCTTTTTTCACCTCTCTCCAGCAGTATATATCTACCGGCACTCCCATCTTTGGCTAGCGACATGAAT
GTTTCTGTCTCCCTGATCAATTTGACTATCACCACATACTTGATATTCCAAGGACTCGCACCTTCTTTCATTGGC
AGCTTTTCTGATAACTATGGACGCCGTCCGGCATATATCATCGCTTTTGCCATTTATCTTGGAGCTAATATTGGC
CTCGCTTTGCAAGACAACTTCACGGCACTGATGATTCTGCGCTGTATGCAGTCCTCGGGCAGCAGTGGAACTATT
GCATTAGGAAGCGCTGTTGTAGCCGATCTCTCGACCCGCGCCGAGCGTGGGAAATACATTGGATACGCTGGAATT
GGACTTGCACTAGGACCGACCCTTGGCCCCGTTATCGGTGGGCTGTTGGACCATTTCCTCGGGTGGCGATCGATA
TTTTGGTTCCTGGTTATTTTGTCGGCTGTTTGCTTGGTGGTGATCCTTATCGTTCTCCCTGAGACGTGTCGAGCT
GTTGTGGGCAATGGGTCGGTGCCGCCAGCCTCGTGGAACCGCCCACTGTGGACATTGTTCGTACGAACATCACGA
TTCGATGACAACCAAGGGACTGCCGATCACTCCACCGTCCACCGATTGAAGAAGCGCCCAAATCCAATTACAGCG
CTCTTGATAGCCACACAAAAAGAGATGGGGTTGGTTTTATTGTACGGATCCTTCTTATACGCAGGGTACATGGCC
GTTATTAGCACTTTGTCGACCCAGTTGGCGAGTCGATTTGGATTCAACTCGATTGAAATTGGATTGTGCTATCTT
CCGATGGGCATCGGAAGCATAAGCTCCCGCTGGGTAGTTGGCCGAGTCATGGACTGGAACTTTCGCCGCGAGGCA
CAGTTGCAGGGAATGATCATTCACAAAAACCGACAGCAAGATATTGAAAAGTTCAATGTCGAACGAGCACGCTTG
GCGATCACTCTTCCACTGATCTATATGGCTAGCCTTTGTATTTTAGCTTACGGTTGGGTGATGCAGTATCGCACT
TCGCTGGCCGGCCCCCTTGTGATGTTGTTCTTCACCGGTCTTACAACCACAAGTGCATTCAACACCTTGAGTACT
TTGGTTGTAGATATCAATCATCAAAGCGCCGCCACTGCTGCGGCAGCAAATAATCTATTTCGCTGTCTATTGGGT
GCGGGGGCCACGGCTATTGCGTCGCCTCTAATCAAATGCATCGGCATTGGATGGACAGGTACATTCATCGCTGGT
CTTTGGGTGTTAGGCAGTCCTGCTCTATGGGTTGTTTTCTACCGAGGGTACCGGTGGAGGAGCGAGCACAAACAG
GATAAACTCACCAATCAGACGCACGCTTGA
Gene >Pro_DTO377G3_2|g9295.t1
ATGCAGCCTGCGCAATCGGATTCTTGTGCAACCGGCCCGCGTCCATCGCCCTTGTGTGAGGTTGGACATGTGATC
AATGGAGAGGAGGACCCTCACACCCTGAATCCAAATCATTCCAAAAAACCAGAAGTTGATCAGAAAATTCAATCG
ATCGGCGATGAACTGGTGCCTCTTTACTGTGTCCTGCCAAATGGCGAGAAGACTTTCGTTATTATGGCGGGATCT
TTTGCAGCCCTTTTTTCACCTCTCTCCAGCAGTATATATCTACCGGCACTCCCATCTTTGGCTAGCGACATGAAT
GTTTCTGTCTCCCTGATCAATTTGACTATCACCACATACTTGGTAATGTCCAACGAGGTAGATAAGGAGAATATG
AAGCTAATTATTTCTAGATATTCCAAGGACTCGCACCTTCTTTCATTGGCAGCTTTTCTGATAACTATGGACGCC
GTCCGGCATATATCATCGCTTTTGCCATTTATCTTGGAGCTAATATTGGCCTCGCTTTGCAAGACAACTTCACGG
CACTGATGATTCTGCGCTGTATGCAGTCCTCGGGCAGCAGTGGAACTATTGCATTAGGAAGCGCTGTTGTAGCCG
ATCTCTCGACCCGCGCCGAGCGTGGGAAATACATTGGATACGCTGGAATTGGACTTGCACTAGGACCGACCCTTG
GCCCCGTTATCGGTGGGCTGTTGGACCATTTCCTCGGGTGGCGATCGATATTTTGGTTCCTGGTTATTTTGTCGG
CTGTTTGCTTGGTGGTGATCCTTATCGTTCTCCCTGAGACGTGTCGAGCTGTTGTGGGCAATGGGTCGGTGCCGC
CAGCCTCGTGGAACCGCCCACTGTGGACATTGTTCGTACGAACATCACGATTCGATGACAACCAAGGGACTGCCG
ATCACTCCACCGTCCACCGATTGAAGAAGCGCCCAAATCCAATTACAGCGCTCTTGATAGCCACACAAAAAGAGA
TGGGGTTGGTTTTATTGTACGGATCCTTCTTATACGCAGGGTACATGGCCGTTATTAGCACTTTGTCGACCCAGT
TGGCGAGTCGATTTGGATTCAACTCGATTGAAATTGGATTGTGCTATCTTCCGATGGGCATCGGAAGCATAAGCT
CCCGCTGGGTAGTTGGCCGAGTCATGGACTGGAACTTTCGCCGCGAGGCACAGTTGCAGGGAATGATCATTCACA
AAAACCGACAGCAAGATATTGAAAAGTTCAATGTCGAACGAGCACGCTTGGCGATCACTCTTCCACTGATCTATA
TGGCTAGCCTTTGTATTTTAGCTTACGGTTGGGTGATGCAGTATCGCACTTCGCTGGCCGGCCCCCTTGTGATGT
TGTTCTTCACCGGTCTTACAACCACAAGTGCATTCAACACCTTGAGTACTTTGGTTGTAGATATCAATCATCAAA
GCGCCGCCACTGCTGCGGCAGCAAATAATCTATTTCGCTGTCTATTGGGTGCGGGGGCCACGGCTATTGCGTCGC
CTCTAATCAAATGCATCGGCATTGGATGGACAGGTACATTCATCGCTGGTCTTTGGGTGTTAGGCAGTCCTGCTC
TATGGGTTGTTTTCTACCGAGGGTACCGGTGGAGGAGCGAGCACAAACAGGATAAACTCACCAATCAGACGCACG
CTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail