Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9285.t1
Gene name
Locationscaffold_44:128906..130811
Strand+
Gene length (bp)1905
Transcript length (bp)1848
Coding sequence length (bp)1848
Protein length (aa) 616

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15963 Myb_DNA-bind_7 Myb DNA-binding like 4.7E-30 454 538
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 9.9E-06 462 504

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 49.44 29.97 68.90
5d_25C Five days - 25 degrees Celsius 60.72 36.94 84.50
7d_25C Seven days - 25 degrees Celsius 57.50 35.01 79.99
10d_25C Ten days - 25 degrees Celsius 68.99 42.00 95.98
7d_15C Seven days - 15 degrees Celsius 64.36 39.01 89.72
7d_30C Seven days - 30 degrees Celsius 59.64 36.50 82.78

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.407139 no
3d_25C 7d_25C 0.571653 no
3d_25C 7d_15C 0.251113 no
3d_25C 7d_30C 0.451147 no
3d_25C 10d_25C 0.133313 no
5d_25C 7d_25C 0.867469 no
5d_25C 7d_15C 0.852846 no
5d_25C 7d_30C 0.957734 no
5d_25C 10d_25C 0.645662 no
7d_25C 7d_15C 0.688685 no
7d_25C 7d_30C 0.911734 no
7d_25C 10d_25C 0.477318 no
7d_15C 7d_30C 0.795887 no
7d_15C 10d_25C 0.822410 no
7d_30C 10d_25C 0.575937 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9285.t1
MKSFSSSAINKTGKKFAPKAPIRRAPAAAPARRPSVAQPSPAEPVQEDKAKDVASSDLTPSVDAEQEPRAVTASS
PASVAAPITEQTPIALNAAVTPSITTTAAITAPIVTQTVTPTATPIAKPTPIPKPTTISKPTQIPKPAAIPLPQK
RKASISISQPAPVLTAPPTPPSTQPTPPPANVPTSEAQPVSEDHGPENALLEYARIETARAAETLVDSNEALPQS
QPETGQAAPVEGRPAKRARTLSTTVTAVPARKESVSVGASRRGSQSIVPTIEDSSATAGESNLSTPDPTKPRKRK
YSKTGTSDPEGSEKPKRTRKKREPTPDGAETVEILPNVVKMSELCKDLRTGKKSKRETELRKIDKAEEERKKQGG
TPGPGTGTPVKQTEPEQEKTEQPVDWKPQSGPIMRIVNGEIVLDNTSLQVDRHADAARAAGDLEDVVESSFTRKI
NQASYGKRTKTEAWDEDMTELFYRGLRMFGTDFMVISKMFPGRSRRQIKLKFNNEERRDPQRIKDTLMGPSETID
IATYSEMTNTVYDDPKLVQQELDDEKKRIEDQHAKEKEMQEEMLRNPTSDSKDVKNDNTTVKKSRKKAGVKNQGG
GTEEVLGSIDDFPTA*
Coding >Pro_DTO377G3_2|g9285.t1
ATGAAGTCCTTCTCCAGTTCTGCAATCAATAAAACCGGCAAGAAATTCGCTCCGAAGGCGCCTATCCGCCGTGCG
CCCGCCGCCGCGCCCGCGAGACGACCTAGTGTTGCCCAACCGTCACCAGCTGAGCCCGTTCAGGAAGATAAAGCT
AAAGATGTAGCTTCCTCTGATCTGACGCCCTCTGTGGATGCAGAACAGGAGCCGCGGGCAGTCACAGCATCCTCA
CCTGCGTCGGTAGCTGCGCCTATCACGGAACAAACGCCCATTGCTTTGAACGCTGCAGTCACTCCTTCGATTACT
ACTACTGCTGCTATCACCGCTCCCATCGTTACACAGACTGTCACACCTACTGCTACACCCATCGCAAAGCCGACT
CCGATCCCTAAGCCGACTACAATCTCAAAGCCGACTCAAATTCCTAAGCCAGCTGCGATTCCTCTCCCACAGAAA
CGCAAAGCCTCTATCTCTATCTCGCAACCCGCGCCTGTCTTGACTGCTCCACCTACCCCTCCTTCCACCCAGCCG
ACCCCACCTCCCGCAAATGTCCCGACTAGTGAGGCTCAACCTGTATCTGAGGATCATGGACCAGAGAACGCTCTT
TTAGAGTACGCTAGGATTGAAACAGCGCGGGCCGCAGAAACCCTTGTCGATTCAAATGAAGCTCTGCCGCAATCT
CAACCAGAAACTGGACAAGCTGCCCCAGTCGAGGGTCGACCAGCAAAACGCGCTCGAACTTTATCAACTACAGTC
ACTGCGGTCCCAGCTCGAAAGGAGTCCGTATCCGTAGGGGCAAGTCGTCGAGGCTCTCAGTCAATCGTGCCTACC
ATCGAAGATTCAAGTGCAACGGCCGGTGAATCCAACCTTTCGACTCCCGATCCAACCAAGCCAAGGAAACGAAAG
TACTCAAAGACCGGTACCTCTGATCCTGAGGGTAGTGAGAAACCAAAGCGCACCCGCAAGAAGCGCGAACCAACC
CCGGATGGCGCAGAAACAGTAGAAATTTTGCCGAATGTTGTGAAAATGTCCGAACTTTGCAAAGATCTTAGAACT
GGAAAGAAGTCCAAACGCGAGACAGAGCTACGCAAGATTGATAAGGCCGAAGAAGAACGGAAGAAGCAGGGCGGA
ACCCCTGGGCCGGGAACAGGAACGCCCGTCAAGCAGACTGAGCCTGAACAAGAGAAAACCGAACAGCCAGTCGAC
TGGAAACCCCAAAGTGGCCCTATAATGCGAATCGTTAACGGTGAGATCGTGCTGGATAATACGTCCTTGCAGGTC
GATCGTCATGCGGATGCTGCCAGAGCCGCCGGTGACCTCGAAGATGTGGTGGAAAGCTCATTCACCCGGAAGATT
AATCAGGCCTCGTACGGCAAACGTACAAAGACGGAAGCGTGGGATGAAGATATGACAGAACTGTTTTATCGCGGT
CTCCGCATGTTCGGTACCGATTTCATGGTTATCAGCAAAATGTTCCCGGGTCGCTCTCGTCGTCAGATCAAGTTA
AAGTTTAACAATGAAGAACGCCGTGATCCGCAACGAATCAAAGACACCTTGATGGGACCTTCTGAGACTATCGAC
ATCGCAACATACTCAGAGATGACCAACACTGTTTACGATGATCCCAAGCTTGTCCAGCAGGAACTTGACGATGAA
AAGAAGCGGATTGAGGACCAGCACGCTAAGGAGAAGGAAATGCAAGAGGAAATGCTGCGCAACCCGACTAGCGAT
TCCAAGGATGTCAAGAACGACAACACGACCGTGAAGAAGTCGCGCAAGAAGGCGGGTGTGAAGAACCAGGGAGGC
GGTACAGAGGAGGTTCTGGGATCAATCGATGACTTTCCCACGGCTTAA
Transcript >Pro_DTO377G3_2|g9285.t1
ATGAAGTCCTTCTCCAGTTCTGCAATCAATAAAACCGGCAAGAAATTCGCTCCGAAGGCGCCTATCCGCCGTGCG
CCCGCCGCCGCGCCCGCGAGACGACCTAGTGTTGCCCAACCGTCACCAGCTGAGCCCGTTCAGGAAGATAAAGCT
AAAGATGTAGCTTCCTCTGATCTGACGCCCTCTGTGGATGCAGAACAGGAGCCGCGGGCAGTCACAGCATCCTCA
CCTGCGTCGGTAGCTGCGCCTATCACGGAACAAACGCCCATTGCTTTGAACGCTGCAGTCACTCCTTCGATTACT
ACTACTGCTGCTATCACCGCTCCCATCGTTACACAGACTGTCACACCTACTGCTACACCCATCGCAAAGCCGACT
CCGATCCCTAAGCCGACTACAATCTCAAAGCCGACTCAAATTCCTAAGCCAGCTGCGATTCCTCTCCCACAGAAA
CGCAAAGCCTCTATCTCTATCTCGCAACCCGCGCCTGTCTTGACTGCTCCACCTACCCCTCCTTCCACCCAGCCG
ACCCCACCTCCCGCAAATGTCCCGACTAGTGAGGCTCAACCTGTATCTGAGGATCATGGACCAGAGAACGCTCTT
TTAGAGTACGCTAGGATTGAAACAGCGCGGGCCGCAGAAACCCTTGTCGATTCAAATGAAGCTCTGCCGCAATCT
CAACCAGAAACTGGACAAGCTGCCCCAGTCGAGGGTCGACCAGCAAAACGCGCTCGAACTTTATCAACTACAGTC
ACTGCGGTCCCAGCTCGAAAGGAGTCCGTATCCGTAGGGGCAAGTCGTCGAGGCTCTCAGTCAATCGTGCCTACC
ATCGAAGATTCAAGTGCAACGGCCGGTGAATCCAACCTTTCGACTCCCGATCCAACCAAGCCAAGGAAACGAAAG
TACTCAAAGACCGGTACCTCTGATCCTGAGGGTAGTGAGAAACCAAAGCGCACCCGCAAGAAGCGCGAACCAACC
CCGGATGGCGCAGAAACAGTAGAAATTTTGCCGAATGTTGTGAAAATGTCCGAACTTTGCAAAGATCTTAGAACT
GGAAAGAAGTCCAAACGCGAGACAGAGCTACGCAAGATTGATAAGGCCGAAGAAGAACGGAAGAAGCAGGGCGGA
ACCCCTGGGCCGGGAACAGGAACGCCCGTCAAGCAGACTGAGCCTGAACAAGAGAAAACCGAACAGCCAGTCGAC
TGGAAACCCCAAAGTGGCCCTATAATGCGAATCGTTAACGGTGAGATCGTGCTGGATAATACGTCCTTGCAGGTC
GATCGTCATGCGGATGCTGCCAGAGCCGCCGGTGACCTCGAAGATGTGGTGGAAAGCTCATTCACCCGGAAGATT
AATCAGGCCTCGTACGGCAAACGTACAAAGACGGAAGCGTGGGATGAAGATATGACAGAACTGTTTTATCGCGGT
CTCCGCATGTTCGGTACCGATTTCATGGTTATCAGCAAAATGTTCCCGGGTCGCTCTCGTCGTCAGATCAAGTTA
AAGTTTAACAATGAAGAACGCCGTGATCCGCAACGAATCAAAGACACCTTGATGGGACCTTCTGAGACTATCGAC
ATCGCAACATACTCAGAGATGACCAACACTGTTTACGATGATCCCAAGCTTGTCCAGCAGGAACTTGACGATGAA
AAGAAGCGGATTGAGGACCAGCACGCTAAGGAGAAGGAAATGCAAGAGGAAATGCTGCGCAACCCGACTAGCGAT
TCCAAGGATGTCAAGAACGACAACACGACCGTGAAGAAGTCGCGCAAGAAGGCGGGTGTGAAGAACCAGGGAGGC
GGTACAGAGGAGGTTCTGGGATCAATCGATGACTTTCCCACGGCTTAA
Gene >Pro_DTO377G3_2|g9285.t1
ATGAAGTCCTTCTCCAGTTCTGCAATCAGTGAGTATATATGGACCAGAAGAATAAGTATGCAATCTCTGACCGTG
CGTTTGATAGATAAAACCGGCAAGAAATTCGCTCCGAAGGCGCCTATCCGCCGTGCGCCCGCCGCCGCGCCCGCG
AGACGACCTAGTGTTGCCCAACCGTCACCAGCTGAGCCCGTTCAGGAAGATAAAGCTAAAGATGTAGCTTCCTCT
GATCTGACGCCCTCTGTGGATGCAGAACAGGAGCCGCGGGCAGTCACAGCATCCTCACCTGCGTCGGTAGCTGCG
CCTATCACGGAACAAACGCCCATTGCTTTGAACGCTGCAGTCACTCCTTCGATTACTACTACTGCTGCTATCACC
GCTCCCATCGTTACACAGACTGTCACACCTACTGCTACACCCATCGCAAAGCCGACTCCGATCCCTAAGCCGACT
ACAATCTCAAAGCCGACTCAAATTCCTAAGCCAGCTGCGATTCCTCTCCCACAGAAACGCAAAGCCTCTATCTCT
ATCTCGCAACCCGCGCCTGTCTTGACTGCTCCACCTACCCCTCCTTCCACCCAGCCGACCCCACCTCCCGCAAAT
GTCCCGACTAGTGAGGCTCAACCTGTATCTGAGGATCATGGACCAGAGAACGCTCTTTTAGAGTACGCTAGGATT
GAAACAGCGCGGGCCGCAGAAACCCTTGTCGATTCAAATGAAGCTCTGCCGCAATCTCAACCAGAAACTGGACAA
GCTGCCCCAGTCGAGGGTCGACCAGCAAAACGCGCTCGAACTTTATCAACTACAGTCACTGCGGTCCCAGCTCGA
AAGGAGTCCGTATCCGTAGGGGCAAGTCGTCGAGGCTCTCAGTCAATCGTGCCTACCATCGAAGATTCAAGTGCA
ACGGCCGGTGAATCCAACCTTTCGACTCCCGATCCAACCAAGCCAAGGAAACGAAAGTACTCAAAGACCGGTACC
TCTGATCCTGAGGGTAGTGAGAAACCAAAGCGCACCCGCAAGAAGCGCGAACCAACCCCGGATGGCGCAGAAACA
GTAGAAATTTTGCCGAATGTTGTGAAAATGTCCGAACTTTGCAAAGATCTTAGAACTGGAAAGAAGTCCAAACGC
GAGACAGAGCTACGCAAGATTGATAAGGCCGAAGAAGAACGGAAGAAGCAGGGCGGAACCCCTGGGCCGGGAACA
GGAACGCCCGTCAAGCAGACTGAGCCTGAACAAGAGAAAACCGAACAGCCAGTCGACTGGAAACCCCAAAGTGGC
CCTATAATGCGAATCGTTAACGGTGAGATCGTGCTGGATAATACGTCCTTGCAGGTCGATCGTCATGCGGATGCT
GCCAGAGCCGCCGGTGACCTCGAAGATGTGGTGGAAAGCTCATTCACCCGGAAGATTAATCAGGCCTCGTACGGC
AAACGTACAAAGACGGAAGCGTGGGATGAAGATATGACAGAACTGTTTTATCGCGGTCTCCGCATGTTCGGTACC
GATTTCATGGTTATCAGCAAAATGTTCCCGGGTCGCTCTCGTCGTCAGATCAAGTTAAAGTTTAACAATGAAGAA
CGCCGTGATCCGCAACGAATCAAAGACACCTTGATGGGACCTTCTGAGACTATCGACATCGCAACATACTCAGAG
ATGACCAACACTGTTTACGATGATCCCAAGCTTGTCCAGCAGGAACTTGACGATGAAAAGAAGCGGATTGAGGAC
CAGCACGCTAAGGAGAAGGAAATGCAAGAGGAAATGCTGCGCAACCCGACTAGCGATTCCAAGGATGTCAAGAAC
GACAACACGACCGTGAAGAAGTCGCGCAAGAAGGCGGGTGTGAAGAACCAGGGAGGCGGTACAGAGGAGGTTCTG
GGATCAATCGATGACTTTCCCACGGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail