Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9284.t1
Gene name
Locationscaffold_44:126095..128572
Strand-
Gene length (bp)2477
Transcript length (bp)2163
Coding sequence length (bp)2163
Protein length (aa) 721

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08647 BRE1 BRE1 E3 ubiquitin ligase 1.9E-26 472 566
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.9E-09 668 706
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 8.6E-09 667 709
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.5E-07 668 706
PF13445 zf-RING_UBOX RING-type zinc-finger 2.1E-07 668 704
PF13639 zf-RING_2 Ring finger domain 3.0E-07 668 706
PF14447 Prok-RING_4 Prokaryotic RING finger family 4 1.7E-06 668 711

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 55.70 34.15 77.26
5d_25C Five days - 25 degrees Celsius 67.28 41.30 93.27
7d_25C Seven days - 25 degrees Celsius 73.66 45.22 102.09
10d_25C Ten days - 25 degrees Celsius 91.07 55.57 126.56
7d_15C Seven days - 15 degrees Celsius 63.81 39.12 88.49
7d_30C Seven days - 30 degrees Celsius 73.00 44.78 101.21

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.431312 no
3d_25C 7d_25C 0.200865 no
3d_25C 7d_15C 0.599373 no
3d_25C 7d_30C 0.221110 no
3d_25C 10d_25C 0.014096 yes
5d_25C 7d_25C 0.749068 no
5d_25C 7d_15C 0.862300 no
5d_25C 7d_30C 0.775869 no
5d_25C 10d_25C 0.161481 no
7d_25C 7d_15C 0.571936 no
7d_25C 7d_30C 0.978118 no
7d_25C 10d_25C 0.369883 no
7d_15C 7d_30C 0.608690 no
7d_15C 10d_25C 0.094678 no
7d_30C 10d_25C 0.351672 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9284.t1
MPAVEPPVKSSESGLIKMEDRKRPAADHNDSAPPLKKQATTVNGGSKPHPDADMPWKDDLERFQKEAILRQMQEY
KREKSSLESRLSQMSKAATFHNDHLRVIDLWFKQLIDEVKLLLGPPQAEDQETPFKSSLQFEDVEEFETHLKSRS
EDIHAIISQVQSKSNDAPIEISEVQTRLAKKLAEEKVTIAELEKTLAEKQQLEESLEEASLRYLVAEKKLDRAKS
LTVAKLEKQQSMGIQRPGETSQSKREGSTPANGTPAGDRNPELEEANNKLTAISETQKEQVRKLEAENASLLGQI
TEIKVKSSKFTDDDYAHTDLFKHLRSQYDDVVKRINHLEATNVQLREEAEKYRSERIAYKIQVEDETQSTIAEKE
AQLMRAETDLARIRNARDELLADQQMRKAAQDQKKTSSLKLQELADAREARITALESESQRLRLQIEGSKSDDNI
NDMPLEELRAKYTSLERQYSMLNTELTSMQTAYTKFATLASQKVTDFAAMEERVARLTAEKSKADQKFFAAMKSK
EARDVEVRTLRMQSSKTSDIVAQLKESEAATRSLVSNMDKQANETKEALNSALSKHRALQQQLTESNILMEGLKH
QVSELKGLSTSKDSTLASTTSALRQAETEVAGLKQSLSDTKKSLDNWKTKSLGNSSSEYEMLRTLALCTVCRRNF
KNTVIKTCGHVFCKDCVAERLTSRSRKCPNCGKSFGSNDHMHITL*
Coding >Pro_DTO377G3_2|g9284.t1
ATGCCGGCCGTCGAACCCCCCGTCAAGTCTTCAGAGTCCGGTCTTATCAAAATGGAAGACCGGAAGAGGCCCGCT
GCGGACCATAATGACTCAGCCCCGCCGTTAAAGAAACAGGCTACCACCGTTAACGGTGGTAGTAAGCCTCATCCT
GATGCCGACATGCCATGGAAAGATGATTTGGAACGATTTCAAAAAGAAGCGATTTTGCGCCAGATGCAAGAGTAC
AAGCGGGAGAAATCCTCACTGGAATCACGCTTGAGCCAGATGTCAAAGGCTGCCACGTTTCATAATGATCATCTT
CGTGTTATCGATTTGTGGTTCAAACAGCTGATTGATGAAGTGAAATTGCTACTTGGGCCACCGCAAGCAGAAGAC
CAAGAAACCCCTTTTAAAAGCTCCTTGCAGTTTGAAGACGTTGAAGAGTTTGAGACGCATTTGAAATCGCGGTCG
GAGGATATTCACGCAATAATTTCTCAAGTTCAGTCCAAGTCTAATGATGCGCCTATCGAAATTTCAGAGGTACAG
ACTCGCCTTGCAAAGAAGTTGGCCGAGGAGAAAGTGACGATCGCCGAACTCGAAAAAACCCTGGCCGAGAAGCAA
CAGTTGGAGGAAAGCCTTGAGGAAGCCTCCCTGCGATATTTGGTAGCTGAAAAGAAACTGGATCGTGCGAAGAGT
CTGACTGTTGCAAAATTGGAAAAGCAGCAGTCTATGGGTATTCAACGACCTGGGGAAACGTCACAATCAAAGCGC
GAAGGATCGACCCCGGCCAATGGAACCCCCGCCGGAGACCGCAACCCCGAATTGGAAGAAGCCAATAACAAGCTC
ACTGCAATTTCGGAGACACAGAAGGAGCAAGTCCGGAAACTCGAAGCCGAAAATGCCAGTTTACTAGGCCAAATC
ACCGAAATCAAAGTCAAGTCTTCAAAGTTCACCGATGACGATTACGCCCATACGGATTTGTTTAAACACCTTCGA
TCACAGTACGACGATGTAGTTAAGCGAATCAACCATCTGGAAGCGACAAATGTTCAACTTCGTGAGGAAGCAGAG
AAATACCGCTCGGAAAGAATCGCATACAAGATCCAGGTTGAAGATGAAACACAAAGTACGATTGCCGAGAAGGAA
GCTCAGCTGATGAGGGCTGAAACGGACCTGGCTCGGATACGGAATGCCCGCGACGAACTTTTAGCCGACCAACAG
ATGCGAAAGGCCGCGCAAGATCAGAAGAAGACTTCTAGTCTGAAACTGCAAGAACTAGCAGACGCTAGAGAGGCT
CGAATTACAGCTTTAGAGTCAGAGAGTCAAAGGTTGCGGCTGCAGATTGAGGGCTCCAAGTCCGACGACAATATC
AACGATATGCCGCTAGAGGAGCTTCGCGCCAAGTACACCAGCCTAGAACGCCAGTACTCCATGCTCAACACCGAG
TTGACATCGATGCAGACGGCCTACACGAAGTTTGCTACTCTCGCATCGCAGAAAGTTACCGACTTTGCGGCTATG
GAAGAGAGGGTTGCAAGGCTGACGGCGGAGAAGTCTAAAGCAGATCAGAAGTTCTTTGCTGCAATGAAAAGCAAA
GAAGCACGGGATGTCGAAGTGCGAACGCTTAGAATGCAAAGCTCCAAAACGTCGGATATTGTGGCCCAGCTGAAG
GAGTCCGAAGCAGCTACTCGGTCATTAGTGTCCAACATGGACAAGCAAGCCAATGAGACCAAGGAGGCACTAAAT
TCAGCCCTGAGCAAGCACCGCGCCCTTCAGCAACAGTTGACCGAGAGCAATATTCTCATGGAAGGCTTGAAACAT
CAGGTTTCTGAGCTCAAAGGGCTTTCAACATCCAAGGACTCGACACTGGCAAGCACTACTTCTGCTTTGCGGCAA
GCTGAGACAGAGGTCGCTGGTTTGAAACAGTCCCTTTCAGATACCAAGAAGAGTCTGGACAACTGGAAGACCAAG
AGTCTTGGCAATTCGTCCTCGGAATATGAAATGCTGCGGACACTTGCACTGTGTACGGTGTGTCGTCGCAATTTC
AAAAATACGGTGATCAAGACATGTGGCCATGTTTTCTGCAAAGATTGCGTCGCAGAGCGTCTCACGTCGCGCTCC
CGCAAGTGCCCGAACTGCGGCAAATCTTTCGGAAGCAACGACCACATGCACATTACCCTCTGA
Transcript >Pro_DTO377G3_2|g9284.t1
ATGCCGGCCGTCGAACCCCCCGTCAAGTCTTCAGAGTCCGGTCTTATCAAAATGGAAGACCGGAAGAGGCCCGCT
GCGGACCATAATGACTCAGCCCCGCCGTTAAAGAAACAGGCTACCACCGTTAACGGTGGTAGTAAGCCTCATCCT
GATGCCGACATGCCATGGAAAGATGATTTGGAACGATTTCAAAAAGAAGCGATTTTGCGCCAGATGCAAGAGTAC
AAGCGGGAGAAATCCTCACTGGAATCACGCTTGAGCCAGATGTCAAAGGCTGCCACGTTTCATAATGATCATCTT
CGTGTTATCGATTTGTGGTTCAAACAGCTGATTGATGAAGTGAAATTGCTACTTGGGCCACCGCAAGCAGAAGAC
CAAGAAACCCCTTTTAAAAGCTCCTTGCAGTTTGAAGACGTTGAAGAGTTTGAGACGCATTTGAAATCGCGGTCG
GAGGATATTCACGCAATAATTTCTCAAGTTCAGTCCAAGTCTAATGATGCGCCTATCGAAATTTCAGAGGTACAG
ACTCGCCTTGCAAAGAAGTTGGCCGAGGAGAAAGTGACGATCGCCGAACTCGAAAAAACCCTGGCCGAGAAGCAA
CAGTTGGAGGAAAGCCTTGAGGAAGCCTCCCTGCGATATTTGGTAGCTGAAAAGAAACTGGATCGTGCGAAGAGT
CTGACTGTTGCAAAATTGGAAAAGCAGCAGTCTATGGGTATTCAACGACCTGGGGAAACGTCACAATCAAAGCGC
GAAGGATCGACCCCGGCCAATGGAACCCCCGCCGGAGACCGCAACCCCGAATTGGAAGAAGCCAATAACAAGCTC
ACTGCAATTTCGGAGACACAGAAGGAGCAAGTCCGGAAACTCGAAGCCGAAAATGCCAGTTTACTAGGCCAAATC
ACCGAAATCAAAGTCAAGTCTTCAAAGTTCACCGATGACGATTACGCCCATACGGATTTGTTTAAACACCTTCGA
TCACAGTACGACGATGTAGTTAAGCGAATCAACCATCTGGAAGCGACAAATGTTCAACTTCGTGAGGAAGCAGAG
AAATACCGCTCGGAAAGAATCGCATACAAGATCCAGGTTGAAGATGAAACACAAAGTACGATTGCCGAGAAGGAA
GCTCAGCTGATGAGGGCTGAAACGGACCTGGCTCGGATACGGAATGCCCGCGACGAACTTTTAGCCGACCAACAG
ATGCGAAAGGCCGCGCAAGATCAGAAGAAGACTTCTAGTCTGAAACTGCAAGAACTAGCAGACGCTAGAGAGGCT
CGAATTACAGCTTTAGAGTCAGAGAGTCAAAGGTTGCGGCTGCAGATTGAGGGCTCCAAGTCCGACGACAATATC
AACGATATGCCGCTAGAGGAGCTTCGCGCCAAGTACACCAGCCTAGAACGCCAGTACTCCATGCTCAACACCGAG
TTGACATCGATGCAGACGGCCTACACGAAGTTTGCTACTCTCGCATCGCAGAAAGTTACCGACTTTGCGGCTATG
GAAGAGAGGGTTGCAAGGCTGACGGCGGAGAAGTCTAAAGCAGATCAGAAGTTCTTTGCTGCAATGAAAAGCAAA
GAAGCACGGGATGTCGAAGTGCGAACGCTTAGAATGCAAAGCTCCAAAACGTCGGATATTGTGGCCCAGCTGAAG
GAGTCCGAAGCAGCTACTCGGTCATTAGTGTCCAACATGGACAAGCAAGCCAATGAGACCAAGGAGGCACTAAAT
TCAGCCCTGAGCAAGCACCGCGCCCTTCAGCAACAGTTGACCGAGAGCAATATTCTCATGGAAGGCTTGAAACAT
CAGGTTTCTGAGCTCAAAGGGCTTTCAACATCCAAGGACTCGACACTGGCAAGCACTACTTCTGCTTTGCGGCAA
GCTGAGACAGAGGTCGCTGGTTTGAAACAGTCCCTTTCAGATACCAAGAAGAGTCTGGACAACTGGAAGACCAAG
AGTCTTGGCAATTCGTCCTCGGAATATGAAATGCTGCGGACACTTGCACTGTGTACGGTGTGTCGTCGCAATTTC
AAAAATACGGTGATCAAGACATGTGGCCATGTTTTCTGCAAAGATTGCGTCGCAGAGCGTCTCACGTCGCGCTCC
CGCAAGTGCCCGAACTGCGGCAAATCTTTCGGAAGCAACGACCACATGCACATTACCCTCTGA
Gene >Pro_DTO377G3_2|g9284.t1
ATGCCGGCCGTCGAACCCCCCGTCAAGTCTTCAGAGTCCGGTCTTATCAAAATGGAAGACCGGAAGAGGCCCGCT
GCGGACCATAATGACTCAGCCCCGCCGTTAAAGAAACAGGCTACCACCGTTAACGGTGGTAGTAAGCCTCATCCT
GATGCCGACATGCCATGGAAAGATGATTTGGAAGTATGTTTTGGTTCTTCCGCGATCTGGAGATTGGCTTTTGGT
CTCCTATTGGGTATATGCTAATTGGGCATTTTGCGATAGCGATTTCAAAAAGAAGCGATTTTGCGCCAGATGCAA
GAGTACAAGCGGGAGAAATCCTCACTGGAATCACGCTTGAGCCAGATGTCAAAGGCTGCCACGTTTCATAATGAT
CATCTTCGTGTTATCGATTTGTGGTTCAAACAGGTAGCTTTCCCCATTGTTTGTGCCGGTCACTTGGCATGAATT
TGGGAGCAGGAACTAACGCTAGTATAGCTGATTGATGAAGTGAAATTGCTACTTGGGCCACCGCAAGCAGAAGAC
CAAGGTCAGTCCCCTTGTTCTAGCCCCACACCCCACCCACTATTCCAATATTGACAATATTCGCAGAAACCCCTT
TTAAAAGCTCCTTGCAGTTTGAAGACGTTGAAGAGTTTGAGACGCATTTGAAATCGCGGTCGGAGGATATTCACG
CAATAATTTCTCAAGTTCAGTCCAAGTCTAATGATGCGCCTATCGAAATTTCAGAGGTACAGACTCGCCTTGCAA
AGAAGTTGGCCGAGGAGAAAGTGACGATCGCCGAACTCGAAAAAACCCTGGCCGAGAAGCAACAGTTGGAGGAAA
GCCTTGAGGAAGCCTCCCTGCGATATTTGGTAGCTGAAAAGAAACTGGATCGTGCGAAGAGTCTGACTGTTGCAA
AATTGGAAAAGCAGCAGTCTATGGGTATTCAACGACCTGGGGAAACGTCACAATCAAAGCGCGAAGGATCGACCC
CGGCCAATGGAACCCCCGCCGGAGACCGCAACCCCGAATTGGAAGAAGCCAATAACAAGCTCACTGCAATTTCGG
AGACACAGAAGGAGCAAGTCCGGAAACTCGAAGCCGAAAATGCCAGTTTACTAGGCCAAATCACCGAAATCAAAG
TCAAGGTTGGATTCACCTCGTTACGTTGTCATTTTGTCGCTCACATCGGGATCCTAGTCTTCAAAGTTCACCGAT
GACGATTACGCCCATACGGATTTGTTTAAACACCTTCGATCACAGTACGACGATGTAGTTAAGCGAATCAACCAT
CTGGAAGCGACAAATGTTCAACTTCGTGAGGAAGCAGAGAAATACCGCTCGGAAAGAATCGCATACAAGATCCAG
GTTGAAGATGAAACACAAAGTACGATTGCCGAGAAGGAAGCTCAGCTGATGAGGGCTGAAACGGACCTGGCTCGG
ATACGGAATGCCCGCGACGAACTTTTAGCCGACCAACAGATGCGAAAGGCCGCGCAAGATCAGAAGAAGACTTCT
AGTCTGAAACTGCAAGAACTAGCAGACGCTAGAGAGGCTCGAATTACAGCTTTAGAGTCAGAGAGTCAAAGGTTG
CGGCTGCAGATTGAGGGCTCCAAGTCCGACGACAATATCAACGATATGCCGCTAGAGGAGCTTCGCGCCAAGTAC
ACCAGCCTAGAACGCCAGTACTCCATGCTCAACACCGAGTTGACATCGATGCAGACGGCCTACACGAAGTTTGCT
ACTCTCGCATCGCAGAAAGTTACCGACTTTGCGGCTATGGAAGAGAGGGTTGCAAGGCTGACGGCGGAGAAGTCT
AAAGCAGATCAGAAGTTCTTTGCTGCAATGAAAAGCAAAGAAGCACGGGATGTCGAAGTGCGAACGCTTAGAATG
CAAAGCTCCAAAACGTCGGATATTGTGGCCCAGCTGAAGGAGTCCGAAGCAGCTACTCGGTCATTAGTGTCCAAC
ATGGACAAGCAAGCCAATGAGACCAAGGAGGCACTAAATTCAGCCCTGAGCAAGCACCGCGCCCTTCAGCAACAG
TTGACCGAGAGCAATATTCTCATGGAAGGCTTGAAACATCAGGTTTCTGAGCTCAAAGGGCTTTCAACATCCAAG
GACTCGACACTGGCAAGCACTACTTCTGCTTTGCGGCAAGCTGAGACAGAGGTCGCTGGTTTGAAACAGTCCCTT
TCAGATACCAAGAAGAGTCTGGACAACTGGAAGACCAAGAGTCTTGGCAATTCGTCCTCGGAATATGAAATGCTG
CGGGTATGTTGAATTTTCACATTTGTTAATGAATCAGAGCTAACTACGTTCAGACACTTGCACTGTGTACGGTGT
GTCGTCGCAATTTCAAAAATACGGTGATCAAGACATGTGGCCATGTTTTCTGCAAAGATTGCGTCGCAGAGCGTC
TCACGTCGCGCTCCCGCAAGTGCCCGAACTGCGGCAAATCTTTCGGAAGCAACGACCACATGCACATTACCCTCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail