Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9276.t1
Gene name
Locationscaffold_44:106564..108149
Strand+
Gene length (bp)1585
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00647 EF1G Elongation factor 1 gamma, conserved domain 2.5E-41 247 353
PF00043 GST_C Glutathione S-transferase, C-terminal domain 2.9E-15 97 201
PF02798 GST_N Glutathione S-transferase, N-terminal domain 1.7E-11 4 79
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 3.6E-10 131 194
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 1.3E-04 134 205
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 1.4E-04 7 82

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003746 translation elongation factor activity Yes
GO:0006414 translational elongation Yes
GO:0009987 cellular process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0008135 translation factor activity, RNA binding No
GO:1901363 heterocyclic compound binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0045182 translation regulator activity No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0003676 nucleic acid binding No
GO:0003723 RNA binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9276.t1
MAFGKLYGLPDNGRTISILVAAKHNDLDLELVNTQANSTAEFNTSAEYLKINPTGKIPAFEGANGFTLSEAIAIA
VYVTSQNEKTTLLGKTKQDYASILRWLSFVNSEVLPKFGAWYRPLLGLDGYNKKTVDEASKVALKAISAFETHLT
ANTYLVGERITLADIFAASLLTRAFATVLDKTWREANPATTRWYNTIINQDAFKAVVPSPKFAEEVVKYVAPKKE
PKPKAAAPAAAAPVEASTAEPKAKHPLEALGKPTLILDDWKRKFSNEDPRTVAMPWFWEHFNADEYSLWKVNYRY
NNELKLTFMANNLIGGFQTRLEASRKYLFGAQSVYGENYNCVVYGAYMTRGQEWEPAFTVGPDYEGYEFTKLDPS
NEADRKLVEDMWSQDVPVTVDGQVKEWADGHVFK*
Coding >Pro_DTO377G3_2|g9276.t1
ATGGCATTCGGAAAGCTCTACGGTCTGCCTGACAACGGTCGCACCATCTCCATCCTGGTCGCTGCTAAGCACAAC
GACCTCGACTTGGAGCTGGTTAACACCCAGGCCAACTCTACCGCTGAATTCAACACCAGCGCTGAGTACCTCAAG
ATCAACCCCACTGGCAAGATCCCCGCCTTCGAGGGTGCCAATGGCTTCACTCTGTCTGAGGCTATTGCCATTGCC
GTCTATGTTACCTCCCAGAACGAGAAGACCACCCTTCTCGGCAAGACCAAGCAGGATTACGCTTCCATCCTCCGC
TGGTTGTCCTTCGTCAACTCCGAGGTTCTCCCCAAGTTCGGTGCCTGGTACCGTCCTTTGTTGGGTCTGGATGGT
TACAACAAGAAGACTGTCGATGAGGCCTCCAAGGTTGCCCTGAAGGCCATCTCCGCCTTCGAGACTCACCTCACT
GCCAACACCTACCTTGTTGGTGAGCGTATCACTCTGGCCGATATCTTCGCTGCCTCCCTCCTTACCCGTGCTTTC
GCCACTGTCTTGGACAAGACCTGGCGCGAGGCCAACCCCGCCACCACCCGGTGGTACAACACTATTATCAACCAG
GACGCCTTCAAGGCCGTCGTCCCCAGCCCCAAGTTCGCTGAGGAGGTCGTCAAGTACGTCGCCCCCAAGAAGGAG
CCCAAGCCCAAGGCCGCTGCCCCCGCCGCTGCCGCCCCCGTCGAGGCCTCTACCGCTGAGCCTAAGGCTAAGCAC
CCCCTTGAGGCTCTTGGCAAGCCCACTCTTATCCTCGATGACTGGAAGCGCAAGTTCTCCAACGAGGACCCCCGC
ACCGTTGCCATGCCCTGGTTCTGGGAGCACTTCAACGCCGATGAGTACTCTCTCTGGAAGGTCAACTACCGTTAC
AACAACGAGCTCAAGCTCACCTTCATGGCCAACAACTTGATCGGTGGCTTCCAGACTCGTCTCGAGGCTTCCCGC
AAGTACCTCTTCGGTGCTCAGTCCGTTTACGGCGAGAACTACAACTGTGTCGTCTACGGTGCCTACATGACCCGC
GGCCAGGAGTGGGAGCCCGCTTTCACTGTCGGCCCCGACTACGAGGGTTACGAGTTCACCAAGCTCGACCCCTCC
AACGAGGCTGACCGCAAGCTCGTTGAGGACATGTGGTCCCAGGACGTTCCCGTCACTGTTGACGGCCAAGTTAAG
GAGTGGGCCGATGGTCACGTCTTCAAATAA
Transcript >Pro_DTO377G3_2|g9276.t1
ATGGCATTCGGAAAGCTCTACGGTCTGCCTGACAACGGTCGCACCATCTCCATCCTGGTCGCTGCTAAGCACAAC
GACCTCGACTTGGAGCTGGTTAACACCCAGGCCAACTCTACCGCTGAATTCAACACCAGCGCTGAGTACCTCAAG
ATCAACCCCACTGGCAAGATCCCCGCCTTCGAGGGTGCCAATGGCTTCACTCTGTCTGAGGCTATTGCCATTGCC
GTCTATGTTACCTCCCAGAACGAGAAGACCACCCTTCTCGGCAAGACCAAGCAGGATTACGCTTCCATCCTCCGC
TGGTTGTCCTTCGTCAACTCCGAGGTTCTCCCCAAGTTCGGTGCCTGGTACCGTCCTTTGTTGGGTCTGGATGGT
TACAACAAGAAGACTGTCGATGAGGCCTCCAAGGTTGCCCTGAAGGCCATCTCCGCCTTCGAGACTCACCTCACT
GCCAACACCTACCTTGTTGGTGAGCGTATCACTCTGGCCGATATCTTCGCTGCCTCCCTCCTTACCCGTGCTTTC
GCCACTGTCTTGGACAAGACCTGGCGCGAGGCCAACCCCGCCACCACCCGGTGGTACAACACTATTATCAACCAG
GACGCCTTCAAGGCCGTCGTCCCCAGCCCCAAGTTCGCTGAGGAGGTCGTCAAGTACGTCGCCCCCAAGAAGGAG
CCCAAGCCCAAGGCCGCTGCCCCCGCCGCTGCCGCCCCCGTCGAGGCCTCTACCGCTGAGCCTAAGGCTAAGCAC
CCCCTTGAGGCTCTTGGCAAGCCCACTCTTATCCTCGATGACTGGAAGCGCAAGTTCTCCAACGAGGACCCCCGC
ACCGTTGCCATGCCCTGGTTCTGGGAGCACTTCAACGCCGATGAGTACTCTCTCTGGAAGGTCAACTACCGTTAC
AACAACGAGCTCAAGCTCACCTTCATGGCCAACAACTTGATCGGTGGCTTCCAGACTCGTCTCGAGGCTTCCCGC
AAGTACCTCTTCGGTGCTCAGTCCGTTTACGGCGAGAACTACAACTGTGTCGTCTACGGTGCCTACATGACCCGC
GGCCAGGAGTGGGAGCCCGCTTTCACTGTCGGCCCCGACTACGAGGGTTACGAGTTCACCAAGCTCGACCCCTCC
AACGAGGCTGACCGCAAGCTCGTTGAGGACATGTGGTCCCAGGACGTTCCCGTCACTGTTGACGGCCAAGTTAAG
GAGTGGGCCGATGGTCACGTCTTCAAATAA
Gene >Pro_DTO377G3_2|g9276.t1
ATGGCATTCGGAAAGCTCTACGGTCTGCCTGTATGTTTATCTTCGTCTTTGTTATTTTGATGCAATGTCTAATAT
TTTCTAGGACAACGGTCGCACCATCTCCATCCTGGTCGCTGCTAAGCACAACGACCTCGACTTGGAGCTGGTTAA
CACCCAGGCCAACTCTACCGCTGAATTCAACACCAGCGCTGAGTACCTCAAGATCAACCCCACTGGCAAGATCCC
CGCCTTCGAGGGTGCCAATGGCTTCACTCTGTCTGAGGCTATTGCCATTGCCGTCTATGGTATGTGAAAATATCC
TCCCTTTTATGCGTCACCACACACCCCTCGGTCCATTTTTATGCCTCTCTTCTTTATGATGAGACACCATTAGTT
ATCCCTGTCTGAATTATAACTATTGTTATAACAACTGTTGAGAAAAAACAACTCTGAAAAAAATATTGGCTACCC
CGCTCTGCGGGAAAATTTGGACTCGACCACCCCACTCTCTTTTTGAAATGGACATATGGTGCCATTGTCACCTCC
GATTGCTCCATTGTTGGATCCATCGAGTTTCAAACAACTTGACTAACACGTCCTGTTCATAGTTACCTCCCAGAA
CGAGAAGACCACCCTTCTCGGCAAGACCAAGCAGGATTACGCTTCCATCCTCCGCTGGTTGTCCTTCGTCAACTC
CGAGGTTCTCCCCAAGTTCGGTGCCTGGTACCGTCCTTTGTTGGGTCTGGATGGTTACAACAAGAAGACTGTCGA
TGAGGCCTCCAAGGTTGCCCTGAAGGCCATCTCCGCCTTCGAGACTCACCTCACTGCCAACACCTACCTTGTTGG
TGAGCGTATCACTCTGGCCGATATCTTCGCTGCCTCCCTCCTTACCCGTGCTTTCGCCACTGTCTTGGACAAGAC
CTGGCGCGAGGCCAACCCCGCCACCACCCGGTGGTACAACACTATTATCAACCAGGACGCCTTCAAGGCCGTCGT
CCCCAGCCCCAAGTTCGCTGAGGAGGTCGTCAAGTACGTCGCCCCCAAGAAGGAGCCCAAGCCCAAGGCCGCTGC
CCCCGCCGCTGCCGCCCCCGTCGAGGCCTCTACCGCTGAGCCTAAGGCTAAGCACCCCCTTGAGGCTCTTGGCAA
GCCCACTCTTATCCTCGATGACTGGAAGCGCAAGTTCTCCAACGAGGACCCCCGCACCGTTGCCATGCCCTGGTT
CTGGGAGCACTTCAACGCCGATGAGTACTCTCTCTGGAAGGTCAACTACCGTTACAACAACGAGCTCAAGCTCAC
CTTCATGGCCAACAACTTGATCGGTGGCTTCCAGACTCGTCTCGAGGCTTCCCGCAAGTACCTCTTCGGTGCTCA
GTCCGTTTACGGCGAGAACTACAACTGTGTCGTCTACGGTGCCTACATGACCCGCGGCCAGGAGTGGGAGCCCGC
TTTCACTGTCGGCCCCGACTACGAGGGTTACGAGTTCACCAAGCTCGACCCCTCCAACGAGGCTGACCGCAAGCT
CGTTGAGGACATGTGGTCCCAGGACGTTCCCGTCACTGTTGACGGCCAAGTTAAGGAGTGGGCCGATGGTCACGT
CTTCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail