Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9273.t1
Gene name
Locationscaffold_44:97837..98710
Strand+
Gene length (bp)873
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 1.9E-07 156 181
PF13499 EF-hand_7 EF-hand domain pair 1.3E-12 113 180
PF13405 EF-hand_6 EF-hand domain 3.9E-05 45 69
PF13405 EF-hand_6 EF-hand domain 2.1E-05 114 142
PF13202 EF-hand_5 EF hand 2.0E-04 46 68
PF13202 EF-hand_5 EF hand 1.7E-02 118 135
PF13202 EF-hand_5 EF hand 1.0E-05 157 179
PF13833 EF-hand_8 EF-hand domain pair 2.9E-04 90 136
PF13833 EF-hand_8 EF-hand domain pair 7.5E-04 160 181

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 89.05 47.98 130.12
5d_25C Five days - 25 degrees Celsius 128.37 74.07 182.67
7d_25C Seven days - 25 degrees Celsius 157.10 92.88 221.31
10d_25C Ten days - 25 degrees Celsius 224.44 135.95 312.92
7d_15C Seven days - 15 degrees Celsius 141.32 82.50 200.13
7d_30C Seven days - 30 degrees Celsius 129.73 75.02 184.44

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.145347 no
3d_25C 7d_25C 0.014377 yes
3d_25C 7d_15C 0.057058 no
3d_25C 7d_30C 0.134694 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.448781 no
5d_25C 7d_15C 0.760163 no
5d_25C 7d_30C 0.978243 no
5d_25C 10d_25C 0.008469 yes
7d_25C 7d_15C 0.731910 no
7d_25C 7d_30C 0.478789 no
7d_25C 10d_25C 0.115127 no
7d_15C 7d_30C 0.791445 no
7d_15C 10d_25C 0.031528 yes
7d_30C 10d_25C 0.013211 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9273.t1
MEPSTNEPNAAAIYDARRRRGSVGTTQLFDNIVSTSNFNRDEVDRLRKRFMKLDKNANGTIDRDEFLSLPQVSSN
PLATRMIAIFDEDGGGDVDFQEFVTGLSAFSSKGNKQEKLRFAFKVYDIDRDGYISNGELFIVLKMMVGNNLKDV
QLQQIVDKTIMEADKDQDGKISFEEFTDMVENTDVSISMTLNQI*
Coding >Pro_DTO377G3_2|g9273.t1
ATGGAGCCCTCCACCAACGAGCCCAACGCTGCTGCGATTTACGATGCGCGGAGACGCCGCGGCTCCGTGGGTACC
ACCCAGCTCTTCGATAACATTGTGTCTACATCCAACTTCAACCGGGATGAGGTGGATCGCCTGCGCAAGCGCTTC
ATGAAGCTGGATAAGAATGCCAACGGCACTATCGACCGTGATGAATTCCTCTCCCTTCCCCAAGTGTCGTCCAAC
CCACTCGCCACGAGGATGATCGCCATCTTCGACGAAGACGGTGGCGGTGACGTCGACTTCCAGGAATTCGTGACG
GGCCTGTCGGCATTCAGCTCAAAGGGTAACAAGCAAGAGAAACTGCGATTCGCATTCAAGGTGTACGACATTGAC
CGTGACGGTTACATTTCCAACGGCGAGCTCTTCATTGTGCTGAAGATGATGGTCGGCAATAACCTCAAGGACGTG
CAGCTGCAGCAGATCGTCGACAAGACGATTATGGAGGCCGATAAGGATCAGGATGGAAAGATTAGCTTCGAGGAG
TTCACGGATATGGTGGAGAACACAGACGTGAGCATCAGTATGACACTGAATCAAATATGA
Transcript >Pro_DTO377G3_2|g9273.t1
ATGGAGCCCTCCACCAACGAGCCCAACGCTGCTGCGATTTACGATGCGCGGAGACGCCGCGGCTCCGTGGGTACC
ACCCAGCTCTTCGATAACATTGTGTCTACATCCAACTTCAACCGGGATGAGGTGGATCGCCTGCGCAAGCGCTTC
ATGAAGCTGGATAAGAATGCCAACGGCACTATCGACCGTGATGAATTCCTCTCCCTTCCCCAAGTGTCGTCCAAC
CCACTCGCCACGAGGATGATCGCCATCTTCGACGAAGACGGTGGCGGTGACGTCGACTTCCAGGAATTCGTGACG
GGCCTGTCGGCATTCAGCTCAAAGGGTAACAAGCAAGAGAAACTGCGATTCGCATTCAAGGTGTACGACATTGAC
CGTGACGGTTACATTTCCAACGGCGAGCTCTTCATTGTGCTGAAGATGATGGTCGGCAATAACCTCAAGGACGTG
CAGCTGCAGCAGATCGTCGACAAGACGATTATGGAGGCCGATAAGGATCAGGATGGAAAGATTAGCTTCGAGGAG
TTCACGGATATGGTGGAGAACACAGACGTGAGCATCAGTATGACACTGAATCAAATATGA
Gene >Pro_DTO377G3_2|g9273.t1
ATGGAGCCCTCCACCAACGAGCCCAACGCTGCTGCGATTTACGATGCGCGGAGACGCCGCGGCTCCGTGGGTACC
ACCCAGCTCTTCGATAACATTGTGTCTACATCCAACTGTATGTTTTCCCCGGTCGGATAGGGTATGAAGGCGATG
AATCGGGCTTGTGGCTGACTTCGCGACCACAGTCAACCGGGATGAGGTGGATCGCCTGCGCAAGCGCTTCATGAA
GCTGGATAAGGTCAGTTGCGTCGCGCGGATTATGAGAATATGCTCTAACATACTCAACAATCTACAGAATGCCAA
CGGCACTATCGACCGTGATGAATTCCTCTCCCTTCCCCAAGTGTCGTCCAACCCACTCGCCACGAGGTTCGTTGC
TCCCTGGGCATCCACATCCAAACTCCAAACTCCCACCTACGATCTGCGATCTACATATATACACGGACTAGTCCC
TGACCCAACTGTTTTATGCTAGGATGATCGCCATCTTCGACGAAGACGGTGGCGGTGACGTCGACTTCCAGGAAT
TCGTGACGGGCCTGTCGGCATTCAGCTCAAAGGGTAACAAGCAAGAGAAACTGCGATTCGCATTCAAGGTGTACG
ACATTGACCGTGACGGTTACATTTCCAACGGCGAGCTCTTCATTGTGCTGAAGATGATGGTCGGCAATAACCTCA
AGGACGTGCAGCTGCAGCAGATCGTCGACAAGACGATTATGGAGGCCGATAAGGATCAGGATGGAAAGATTAGCT
TCGAGGAGTTCACGGATATGGTGGAGAACACAGACGTGAGCATCAGTATGACACTGAGTATGTTTTGATCCGGGT
TTTCTTATTGGAGGTCTTCGTGCTAACTATGGTCCAGATCAAATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail