Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9268.t1
Gene name
Locationscaffold_44:89000..89494
Strand-
Gene length (bp)494
Transcript length (bp)438
Coding sequence length (bp)438
Protein length (aa) 146

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 37 56 19
3 60 82 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 18.50 5.02 31.97
5d_25C Five days - 25 degrees Celsius 26.70 8.49 44.92
7d_25C Seven days - 25 degrees Celsius 49.43 20.46 78.40
10d_25C Ten days - 25 degrees Celsius 115.23 59.29 171.18
7d_15C Seven days - 15 degrees Celsius 13.95 2.97 24.93
7d_30C Seven days - 30 degrees Celsius 41.46 15.55 67.37

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.411275 no
3d_25C 7d_25C 0.006742 yes
3d_25C 7d_15C 0.596600 no
3d_25C 7d_30C 0.027278 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.080143 no
5d_25C 7d_15C 0.123900 no
5d_25C 7d_30C 0.250173 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.002761 yes
7d_25C 7d_30C 0.679149 no
7d_25C 10d_25C 0.004450 yes
7d_15C 7d_30C 0.007091 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9268.t1
MSWVSILKYPLLLVVGFIIQLLSYLLSTLLFLASPVIYIGHVFLYLALLPLRILVILEGFIYFMTVAVLVGATIG
MILHFTGSVISQFLRIEESNEPRRPRVKQELLYSVPQNHSFDYLAAQLDDRKFLPYSTILEEEENSYESG*
Coding >Pro_DTO377G3_2|g9268.t1
ATGAGTTGGGTATCGATCCTGAAATATCCTCTGTTGCTCGTTGTTGGCTTTATAATCCAATTACTATCCTACTTG
TTGTCAACTCTCCTCTTCCTCGCATCGCCAGTGATCTACATCGGACATGTCTTCTTATACCTGGCACTGCTTCCA
TTGCGTATCCTCGTGATATTAGAGGGATTCATCTATTTCATGACTGTGGCTGTGCTTGTCGGAGCCACTATAGGC
ATGATCCTACATTTTACCGGCAGCGTCATATCACAATTCCTGCGGATTGAAGAGTCAAATGAGCCACGGCGACCT
CGGGTGAAGCAAGAGCTTCTATATTCTGTGCCCCAAAATCATTCTTTCGACTATCTAGCAGCGCAGCTGGATGAT
CGCAAGTTCCTGCCCTACTCGACGATCTTGGAGGAGGAGGAGAACAGCTATGAGTCAGGCTGA
Transcript >Pro_DTO377G3_2|g9268.t1
ATGAGTTGGGTATCGATCCTGAAATATCCTCTGTTGCTCGTTGTTGGCTTTATAATCCAATTACTATCCTACTTG
TTGTCAACTCTCCTCTTCCTCGCATCGCCAGTGATCTACATCGGACATGTCTTCTTATACCTGGCACTGCTTCCA
TTGCGTATCCTCGTGATATTAGAGGGATTCATCTATTTCATGACTGTGGCTGTGCTTGTCGGAGCCACTATAGGC
ATGATCCTACATTTTACCGGCAGCGTCATATCACAATTCCTGCGGATTGAAGAGTCAAATGAGCCACGGCGACCT
CGGGTGAAGCAAGAGCTTCTATATTCTGTGCCCCAAAATCATTCTTTCGACTATCTAGCAGCGCAGCTGGATGAT
CGCAAGTTCCTGCCCTACTCGACGATCTTGGAGGAGGAGGAGAACAGCTATGAGTCAGGCTGA
Gene >Pro_DTO377G3_2|g9268.t1
ATGAGTTGGGTATCGATCCTGAAATATCCTCTGTTGCTCGTTGTTGGCTTTATAATCCAATTACTATCCTACTTG
TTGTCAACTCTCCTCTTCCTCGCATCGCCAGTGATCTACATCGGACATGTCTTCTTATACCTGGCACTGCTTCCA
TTGCGTATCCTCGTGATATTAGAGGTATGCATATCTAAATATCGTAGTCTTTAGTGGTAGCATGTACTAAACTCT
AATAGGGATTCATCTATTTCATGACTGTGGCTGTGCTTGTCGGAGCCACTATAGGCATGATCCTACATTTTACCG
GCAGCGTCATATCACAATTCCTGCGGATTGAAGAGTCAAATGAGCCACGGCGACCTCGGGTGAAGCAAGAGCTTC
TATATTCTGTGCCCCAAAATCATTCTTTCGACTATCTAGCAGCGCAGCTGGATGATCGCAAGTTCCTGCCCTACT
CGACGATCTTGGAGGAGGAGGAGAACAGCTATGAGTCAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail