Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9262.t1
Gene name
Locationscaffold_44:77095..78184
Strand-
Gene length (bp)1089
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06102 RRP36 rRNA biogenesis protein RRP36 3.8E-45 149 319

GO

GO Term Description Terminal node
GO:0000469 cleavage involved in rRNA processing Yes
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090501 RNA phosphodiester bond hydrolysis No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0008150 biological_process No
GO:0090305 nucleic acid phosphodiester bond hydrolysis No
GO:0044238 primary metabolic process No
GO:0016070 RNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9262.t1
MAITDLLNRRVRARPEDEDVFSEASGSDEDSQAGSDAESNSNESHADDSSAEGTDTGSNSDSDSEPDIEEKPESE
ADNDDDFKASLADISFGALAKAQALMREKNKRTPKDGTTAASSTVDEIRTKLREAREEKLAAASKSKSKEKKSRS
SKHAPMEQSSKYAVTRKRTAVELPPAPRSRDPRFDAAVMGHSGVGKHPHGGTAYAFLDEYRASELNELKEQMRKT
KNLQQKEKLKGEIRRAQDKLRSAQNKKREADVQAEHKKREKQLIREGKKASPYYLKNSELQKQVLERKYAEMGSR
ERAKALERRRKKMTSKERKEMPWERRGAEGGEDGGMPNGGKRRRLE*
Coding >Pro_DTO377G3_2|g9262.t1
ATGGCTATTACCGATCTGCTCAATCGCCGAGTGCGAGCTCGACCAGAAGACGAGGATGTCTTCTCTGAAGCATCA
GGTTCCGACGAGGATTCGCAAGCTGGCTCTGATGCCGAATCCAACTCCAACGAATCACACGCAGACGACTCCTCC
GCCGAAGGCACAGACACAGGATCTAATTCCGACTCCGACTCTGAACCAGACATAGAAGAAAAACCAGAATCCGAA
GCCGACAACGACGACGACTTCAAAGCCTCACTAGCAGACATCTCCTTCGGCGCGCTCGCCAAAGCCCAAGCCCTA
ATGCGCGAGAAGAACAAGCGCACACCAAAAGACGGCACCACCGCCGCCTCCTCAACCGTCGACGAAATCCGCACG
AAACTCCGCGAAGCACGCGAAGAAAAGCTCGCGGCAGCCTCGAAGTCCAAATCTAAAGAAAAGAAAAGCCGCTCC
TCGAAGCACGCGCCGATGGAGCAATCGTCCAAATACGCCGTGACGCGCAAGCGCACAGCAGTAGAACTCCCGCCC
GCGCCGCGGTCGCGCGACCCGCGCTTCGACGCAGCCGTCATGGGCCACAGCGGCGTGGGGAAGCACCCGCACGGC
GGAACGGCGTATGCATTCCTGGACGAGTACCGGGCGTCTGAGCTGAACGAGTTGAAGGAGCAGATGCGGAAGACG
AAGAACCTGCAGCAGAAGGAGAAGCTGAAGGGGGAGATTCGGCGGGCGCAGGATAAGCTGCGGTCGGCGCAGAAT
AAGAAGCGCGAGGCGGATGTGCAGGCTGAGCATAAGAAGCGCGAGAAGCAGTTGATTCGGGAGGGTAAGAAGGCT
AGTCCGTACTATCTTAAGAACTCGGAGTTGCAGAAGCAGGTTCTTGAGAGGAAGTATGCGGAGATGGGATCGCGG
GAGCGGGCGAAGGCGCTGGAGAGGAGGCGTAAGAAGATGACTTCTAAGGAGCGGAAGGAGATGCCTTGGGAGAGG
AGGGGGGCGGAGGGTGGTGAGGATGGAGGCATGCCTAATGGAGGGAAGAGGCGGAGGTTGGAGTAA
Transcript >Pro_DTO377G3_2|g9262.t1
ATGGCTATTACCGATCTGCTCAATCGCCGAGTGCGAGCTCGACCAGAAGACGAGGATGTCTTCTCTGAAGCATCA
GGTTCCGACGAGGATTCGCAAGCTGGCTCTGATGCCGAATCCAACTCCAACGAATCACACGCAGACGACTCCTCC
GCCGAAGGCACAGACACAGGATCTAATTCCGACTCCGACTCTGAACCAGACATAGAAGAAAAACCAGAATCCGAA
GCCGACAACGACGACGACTTCAAAGCCTCACTAGCAGACATCTCCTTCGGCGCGCTCGCCAAAGCCCAAGCCCTA
ATGCGCGAGAAGAACAAGCGCACACCAAAAGACGGCACCACCGCCGCCTCCTCAACCGTCGACGAAATCCGCACG
AAACTCCGCGAAGCACGCGAAGAAAAGCTCGCGGCAGCCTCGAAGTCCAAATCTAAAGAAAAGAAAAGCCGCTCC
TCGAAGCACGCGCCGATGGAGCAATCGTCCAAATACGCCGTGACGCGCAAGCGCACAGCAGTAGAACTCCCGCCC
GCGCCGCGGTCGCGCGACCCGCGCTTCGACGCAGCCGTCATGGGCCACAGCGGCGTGGGGAAGCACCCGCACGGC
GGAACGGCGTATGCATTCCTGGACGAGTACCGGGCGTCTGAGCTGAACGAGTTGAAGGAGCAGATGCGGAAGACG
AAGAACCTGCAGCAGAAGGAGAAGCTGAAGGGGGAGATTCGGCGGGCGCAGGATAAGCTGCGGTCGGCGCAGAAT
AAGAAGCGCGAGGCGGATGTGCAGGCTGAGCATAAGAAGCGCGAGAAGCAGTTGATTCGGGAGGGTAAGAAGGCT
AGTCCGTACTATCTTAAGAACTCGGAGTTGCAGAAGCAGGTTCTTGAGAGGAAGTATGCGGAGATGGGATCGCGG
GAGCGGGCGAAGGCGCTGGAGAGGAGGCGTAAGAAGATGACTTCTAAGGAGCGGAAGGAGATGCCTTGGGAGAGG
AGGGGGGCGGAGGGTGGTGAGGATGGAGGCATGCCTAATGGAGGGAAGAGGCGGAGGTTGGAGTAA
Gene >Pro_DTO377G3_2|g9262.t1
ATGGCTATTACCGATCTGCTCAATCGCCGAGTGCGAGCTCGACCAGAAGACGAGGATGTCTTCTCTGAAGCATCA
GGTTCCGACGAGGATTCGCAAGCTGGCTCTGATGCCGAATCCAACTCCAACGAATCAGTAAGCCAACCATACATC
TACTTAAAACCAAATTAACAAACAAAGCAGCACGCAGACGACTCCTCCGCCGAAGGCACAGACACAGGATCTAAT
TCCGACTCCGACTCTGAACCAGACATAGAAGAAAAACCAGAATCCGAAGCCGACAACGACGACGACTTCAAAGCC
TCACTAGCAGACATCTCCTTCGGCGCGCTCGCCAAAGCCCAAGCCCTAATGCGCGAGAAGAACAAGCGCACACCA
AAAGACGGCACCACCGCCGCCTCCTCAACCGTCGACGAAATCCGCACGAAACTCCGCGAAGCACGCGAAGAAAAG
CTCGCGGCAGCCTCGAAGTCCAAATCTAAAGAAAAGAAAAGCCGCTCCTCGAAGCACGCGCCGATGGAGCAATCG
TCCAAATACGCCGTGACGCGCAAGCGCACAGCAGTAGAACTCCCGCCCGCGCCGCGGTCGCGCGACCCGCGCTTC
GACGCAGCCGTCATGGGCCACAGCGGCGTGGGGAAGCACCCGCACGGCGGAACGGCGTATGCATTCCTGGACGAG
TACCGGGCGTCTGAGCTGAACGAGTTGAAGGAGCAGATGCGGAAGACGAAGAACCTGCAGCAGAAGGAGAAGCTG
AAGGGGGAGATTCGGCGGGCGCAGGATAAGCTGCGGTCGGCGCAGAATAAGAAGCGCGAGGCGGATGTGCAGGCT
GAGCATAAGAAGCGCGAGAAGCAGTTGATTCGGGAGGGTAAGAAGGCTAGTCCGTACTATCTTAAGAACTCGGAG
TTGCAGAAGCAGGTTCTTGAGAGGAAGTATGCGGAGATGGGATCGCGGGAGCGGGCGAAGGCGCTGGAGAGGAGG
CGTAAGAAGATGACTTCTAAGGAGCGGAAGGAGATGCCTTGGGAGAGGAGGGGGGCGGAGGGTGGTGAGGATGGA
GGCATGCCTAATGGAGGGAAGAGGCGGAGGTTGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail