Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g9233.t1
Gene name
Locationscaffold_44:3364..4926
Strand-
Gene length (bp)1562
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 457 476 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 45.90 27.21 64.60
5d_25C Five days - 25 degrees Celsius 42.38 24.89 59.87
7d_25C Seven days - 25 degrees Celsius 50.51 29.79 71.23
10d_25C Ten days - 25 degrees Celsius 39.09 22.58 55.60
7d_15C Seven days - 15 degrees Celsius 50.66 30.33 70.99
7d_30C Seven days - 30 degrees Celsius 55.08 33.07 77.08

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.803554 no
3d_25C 7d_25C 0.756936 no
3d_25C 7d_15C 0.744139 no
3d_25C 7d_30C 0.491565 no
3d_25C 10d_25C 0.560862 no
5d_25C 7d_25C 0.513634 no
5d_25C 7d_15C 0.501823 no
5d_25C 7d_30C 0.273741 no
5d_25C 10d_25C 0.795169 no
7d_25C 7d_15C 0.993865 no
7d_25C 7d_30C 0.781026 no
7d_25C 10d_25C 0.300393 no
7d_15C 7d_30C 0.782934 no
7d_15C 10d_25C 0.291375 no
7d_30C 10d_25C 0.134572 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g9233.t1
MRDLELHLSNTDPDSKDHPRCRIICAQHITCLSMEALGSGLSLDPNVFSHHIGTSFKDIEKSTGINKLCNTNIGH
IPSSVGTYEHERNLQIVKRHLGRLSIANVEHAKDLTTRDSIVKSIYLHQDHPITFSVDVPRTIYVQGYQSEDDRT
QAIGRFLRTRVLALQDRVLNRRIARQRFADDSMFCDQGERYSQNGLDILQHITIHVINDAKFQQVLVLFPPCPEF
DGDNSDNDPYVFLDHLRKQEHTKSFKEFCLNRDKKDYESAGASESRRTMSQDVEIFSNDILENQAGTPKGLTDVV
HLIRSYALNAWFDRLQTLKDQLEDLSLQSLSHRSIQHDEDPQDSEEENPTCDGLIDEEGMKGAILRYIASLDGEC
QRLKIDLHAAKIGFSTTGSDSVRTLEQTMEKYTHIRSQMSNLLSETQHLLDMKNSRIQQALTTLEIKESRTFIEQ
AKTVKRLIIISFLFIPLSYVCLALSMKFW*
Coding >Pro_DTO377G3_2|g9233.t1
ATGCGAGACCTAGAATTACACCTTTCCAACACGGATCCTGATTCAAAGGATCACCCTCGCTGTCGAATCATCTGC
GCACAACATATCACGTGTTTGAGCATGGAGGCATTGGGTAGTGGACTTTCTTTGGACCCTAATGTCTTCAGTCAC
CATATCGGGACATCATTCAAGGACATTGAAAAGAGTACAGGTATCAATAAGCTCTGCAACACAAATATTGGCCAT
ATTCCTTCATCTGTCGGTACCTACGAGCACGAGAGAAACCTTCAAATCGTCAAAAGGCACCTAGGGCGACTTTCC
ATTGCCAATGTGGAGCATGCAAAAGATCTAACCACCCGGGATTCGATTGTCAAGTCCATCTACCTTCATCAGGAC
CATCCCATCACATTTTCTGTGGATGTGCCACGAACGATCTATGTGCAAGGATATCAATCTGAGGACGACAGAACA
CAGGCTATTGGAAGATTCCTACGTACAAGAGTGTTGGCACTACAGGACCGAGTGCTGAATCGTCGCATTGCTCGG
CAGCGATTTGCTGACGATAGCATGTTCTGCGACCAAGGTGAACGATATTCACAAAACGGCCTTGACATCCTACAG
CACATTACCATCCATGTCATAAACGACGCGAAATTTCAACAAGTCTTGGTTTTGTTTCCACCTTGTCCAGAATTT
GATGGAGATAATTCAGACAACGATCCTTATGTTTTTCTTGACCATCTGAGAAAGCAAGAACATACCAAATCATTC
AAGGAATTCTGTCTCAATCGGGATAAAAAGGACTATGAATCCGCAGGGGCATCGGAATCTCGACGGACTATGTCT
CAAGACGTTGAAATATTCTCCAATGATATTCTTGAGAATCAAGCTGGTACCCCCAAAGGACTAACGGACGTGGTC
CACCTTATACGATCTTACGCTCTGAATGCATGGTTTGATCGTCTGCAGACATTGAAAGACCAGCTTGAAGATCTC
AGTCTTCAAAGCCTATCCCATCGAAGCATACAACATGACGAAGATCCACAGGATTCAGAGGAGGAAAACCCTACA
TGTGATGGTCTGATTGATGAAGAAGGGATGAAAGGTGCTATTCTTCGCTACATCGCGTCACTCGATGGTGAATGC
CAGCGGTTGAAAATTGATTTGCATGCGGCGAAAATAGGATTTTCCACAACCGGCTCCGACTCTGTTCGAACATTA
GAACAGACAATGGAGAAGTATACTCACATACGATCCCAAATGAGCAACCTTCTCTCTGAAACCCAGCATTTACTC
GACATGAAGAACAGCAGGATACAACAGGCTTTAACAACTCTCGAAATCAAAGAAAGCAGAACGTTCATCGAACAG
GCAAAAACAGTGAAGAGGCTTATCATAATATCCTTCCTTTTTATACCGTTGTCCTACGTCTGCTTGGCATTAAGC
ATGAAATTTTGGTAA
Transcript >Pro_DTO377G3_2|g9233.t1
ATGCGAGACCTAGAATTACACCTTTCCAACACGGATCCTGATTCAAAGGATCACCCTCGCTGTCGAATCATCTGC
GCACAACATATCACGTGTTTGAGCATGGAGGCATTGGGTAGTGGACTTTCTTTGGACCCTAATGTCTTCAGTCAC
CATATCGGGACATCATTCAAGGACATTGAAAAGAGTACAGGTATCAATAAGCTCTGCAACACAAATATTGGCCAT
ATTCCTTCATCTGTCGGTACCTACGAGCACGAGAGAAACCTTCAAATCGTCAAAAGGCACCTAGGGCGACTTTCC
ATTGCCAATGTGGAGCATGCAAAAGATCTAACCACCCGGGATTCGATTGTCAAGTCCATCTACCTTCATCAGGAC
CATCCCATCACATTTTCTGTGGATGTGCCACGAACGATCTATGTGCAAGGATATCAATCTGAGGACGACAGAACA
CAGGCTATTGGAAGATTCCTACGTACAAGAGTGTTGGCACTACAGGACCGAGTGCTGAATCGTCGCATTGCTCGG
CAGCGATTTGCTGACGATAGCATGTTCTGCGACCAAGGTGAACGATATTCACAAAACGGCCTTGACATCCTACAG
CACATTACCATCCATGTCATAAACGACGCGAAATTTCAACAAGTCTTGGTTTTGTTTCCACCTTGTCCAGAATTT
GATGGAGATAATTCAGACAACGATCCTTATGTTTTTCTTGACCATCTGAGAAAGCAAGAACATACCAAATCATTC
AAGGAATTCTGTCTCAATCGGGATAAAAAGGACTATGAATCCGCAGGGGCATCGGAATCTCGACGGACTATGTCT
CAAGACGTTGAAATATTCTCCAATGATATTCTTGAGAATCAAGCTGGTACCCCCAAAGGACTAACGGACGTGGTC
CACCTTATACGATCTTACGCTCTGAATGCATGGTTTGATCGTCTGCAGACATTGAAAGACCAGCTTGAAGATCTC
AGTCTTCAAAGCCTATCCCATCGAAGCATACAACATGACGAAGATCCACAGGATTCAGAGGAGGAAAACCCTACA
TGTGATGGTCTGATTGATGAAGAAGGGATGAAAGGTGCTATTCTTCGCTACATCGCGTCACTCGATGGTGAATGC
CAGCGGTTGAAAATTGATTTGCATGCGGCGAAAATAGGATTTTCCACAACCGGCTCCGACTCTGTTCGAACATTA
GAACAGACAATGGAGAAGTATACTCACATACGATCCCAAATGAGCAACCTTCTCTCTGAAACCCAGCATTTACTC
GACATGAAGAACAGCAGGATACAACAGGCTTTAACAACTCTCGAAATCAAAGAAAGCAGAACGTTCATCGAACAG
GCAAAAACAGTGAAGAGGCTTATCATAATATCCTTCCTTTTTATACCGTTGTCCTACGTCTGCTTGGCATTAAGC
ATGAAATTTTGGTAA
Gene >Pro_DTO377G3_2|g9233.t1
ATGCGAGACCTAGAATTACACCTTTCCAACACGGATCCTGATTCAAAGGATCACCCTCGCTGTCGAATCATCTGC
GCACAACATATCACGTGTTTGAGCATGGAGGCATTGGGTAGTGGACTTTCTTTGGACCCTAATGTCTTCAGTCAC
CATATCGGGACATCATTCAAGGACATTGAAAAGAGTACAGGTATCAATAAGCTCTGCAACACAAATATTGGCCAT
ATTCCTTCATCTGTCGGTACCTACGAGCACGAGAGAAACCTTCAAATCGTCAAAAGGCACCTAGGGCGACTTTCC
ATTGCCAATGTGGAGCATGCAAAAGATCTAACCACCCGGGATTCGATTGTCAAGTCCATCTACCTTCATCAGGAC
CATCCCATCACATTTTCTGTGGATGTGCCACGAACGATCTATGTGCAAGGATATCAATCTGAGGACGACAGAACA
CAGGCTATTGGAAGATTCCTACGTACAAGAGTGTTGGCACTACAGGACCGAGTGCTGAATCGTCGCATTGCTCGG
CAGCGATTTGCTGACGATAGCATGTTCTGCGACCAAGGTGAACGATATTCACAAAACGGCCTTGACATCCTACAG
CACATTACCATCCATGTCATAAACGACGCGAAATTTCAACAAGGTATGGATGACTCTGTGTTTACACATCAATGA
GATCGCACAATTGACCAATTTACCAATTAACTAATTTTGTTAGTCTTGGTTTTGTTTCCACCTTGTCCAGAATTT
GATGGAGATAATTCAGACAACGATCCTTATGTTTTTCTTGACCATCTGAGAAAGCAAGAACATACCAAATCATTC
AAGGAATTCTGTCTCAATCGGGATAAAAAGGACTATGAATCCGCAGGGGCATCGGAATCTCGACGGACTATGTCT
CAAGACGTTGAAATATTCTCCAATGATATTCTTGAGAATCAAGCTGGTACCCCCAAAGGACTAACGGACGTGGTC
CACCTTATACGATCTTACGCTCTGAATGCATGGTTTGATCGTCTGCAGACATTGAAAGACCAGCTTGAAGATCTC
AGTCTTCAAAGCCTATCCCATCGAAGCATACAACATGACGAAGATCCACAGGATTCAGAGGAGGAAAACCCTACA
TGTGATGGTCTGATTGATGAAGAAGGGATGAAAGGTGCTATTCTTCGCTACATCGCGTCACTCGATGGTGAATGC
CAGCGGTTGAAAATTGATTTGCATGCGGCGAAAATAGGATTTTCCACAACCGGCTCCGACTCTGTTCGAACATTA
GAACAGACAATGGAGAAGTATACTCACATACGATCCCAAATGAGCAACCTTCTCTCTGAAACCCAGCATTTACTC
GACATGAAGAACAGCAGGATACAACAGGCTTTAACAACTCTCGAAATCAAAGAAAGCAGAACGTTCATCGAACAG
GCAAAAACAGTGAAGAGGTATGATGTTGGCCAATCTTGAGAGAATTAGGACTGACATATGCTAGGCTTATCATAA
TATCCTTCCTTTTTATACCGTTGTCCTACGTCTGCTTGGCATTAAGCATGAAATTTTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail