Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g923.t1
Gene name
Locationscaffold_01:2445907..2448056
Strand-
Gene length (bp)2149
Transcript length (bp)1983
Coding sequence length (bp)1983
Protein length (aa) 661

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14683 CBM-like Polysaccharide lyase family 4, domain III 2.1E-29 443 657
PF14686 fn3_3 Polysaccharide lyase family 4, domain II 1.9E-26 354 430

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2.75 0.73 4.77
5d_25C Five days - 25 degrees Celsius 1.50 0.29 2.70
7d_25C Seven days - 25 degrees Celsius 1.15 0.14 2.17
10d_25C Ten days - 25 degrees Celsius 1.08 0.16 2.00
7d_15C Seven days - 15 degrees Celsius 2.13 0.55 3.71
7d_30C Seven days - 30 degrees Celsius 3.49 1.01 5.96

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.169507 no
3d_25C 7d_25C 0.058634 no
3d_25C 7d_15C 0.617367 no
3d_25C 7d_30C 0.651675 no
3d_25C 10d_25C 0.038386 yes
5d_25C 7d_25C 0.660250 no
5d_25C 7d_15C 0.469532 no
5d_25C 7d_30C 0.040199 yes
5d_25C 10d_25C 0.561011 no
7d_25C 7d_15C 0.197682 no
7d_25C 7d_30C 0.013513 yes
7d_25C 10d_25C 0.934631 no
7d_15C 7d_30C 0.263861 no
7d_15C 10d_25C 0.153602 no
7d_30C 10d_25C 0.008469 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g923.t1
MWASLLTAFTAGATAATALHIAENQTHITLANARLTAVLQKSVGQIVDLTLDGQDLLGTQSGSTGIGPYLDCYCI
PSGFYTAGATSPSTEVVQGTDSTGTKYGGMILSDTYTPTGQQFQQYWFLRDGETGLHMFSRLAYHNETTPFLRNL
QEFRTLFRPNTDLWTHLTSSEVQTAPLPGKDAISKEIVVQDATWTFNNTPSDAYYTQFSEYFTKYTFSNQWRNNT
VHGLYADGSTSNGVTYGAWLVMNTKDTYYGGPLHSDLTVDGIVYNYIVSNHHGEGTPNITNGFDRTFGPQFYLFN
GGKGSASLEELRSEAEELADPHWNAEFYDSIAKHVIGYAPSSQRGSVRGTVKLPKGAVRPIAILTVDGQYFQDNS
AVPSSYQYWTDINQDGSFSIDRVKEGKYRLTIYAEGIFGDFVRDGIIIHAGRQTALHDTWTQESAGTELWRIGIP
DKSSGEFRRGNARDPTHPLHPPEYLIYWGAYDWRSDFPDGVNYTIGTSDPATDLNSAHWSVFGPTAKDSHVEYDT
TYDWNIHFKLDSKQLNKRKTATLTLQLAAAKTAAGNTDVWNPLESYNNLSLESYINNQADPLTLVVGFNQSSSCI
VRSAVSCYQVGSKLEFPADWLHVGDNVLRLHLPFNATDIETAVLPATVYVQYDAIRLEIQ*
Coding >Pro_DTO377G3_2|g923.t1
ATGTGGGCTTCCTTATTGACGGCCTTCACGGCAGGGGCTACTGCTGCCACGGCGCTACACATCGCAGAAAACCAG
ACTCACATCACTCTCGCCAATGCTCGCCTCACGGCTGTCCTCCAGAAGAGTGTCGGCCAGATAGTCGATCTAACT
TTGGATGGCCAGGACTTGTTGGGCACTCAGTCGGGATCCACTGGAATAGGGCCCTATCTCGACTGTTACTGTATC
CCTTCGGGCTTCTACACAGCCGGTGCCACATCCCCGAGCACGGAGGTAGTGCAGGGCACAGATTCAACTGGAACC
AAATACGGAGGCATGATTCTGAGTGACACATATACTCCGACGGGACAGCAATTCCAACAGTACTGGTTCCTGCGC
GATGGCGAGACTGGTTTGCATATGTTCAGCCGATTGGCCTACCATAATGAGACCACGCCCTTTCTTCGCAACTTG
CAGGAGTTCCGGACCTTGTTTCGTCCAAATACCGATCTTTGGACGCATCTGACGTCTAGCGAGGTCCAGACCGCA
CCCCTGCCAGGCAAGGACGCGATTTCCAAGGAGATTGTTGTTCAAGATGCAACCTGGACATTTAACAACACGCCA
AGCGACGCGTACTACACCCAATTTTCTGAATATTTTACTAAATATACATTCTCAAATCAATGGAGAAACAATACT
GTTCATGGTCTATATGCTGACGGCAGCACCTCAAATGGGGTAACATATGGAGCTTGGCTAGTCATGAATACCAAG
GATACATATTATGGGGGACCACTCCATTCCGACTTAACAGTGGACGGTATAGTGTACAACTATATCGTATCAAAT
CATCATGGAGAGGGCACGCCAAACATCACAAACGGATTCGATCGAACTTTCGGTCCCCAATTTTACCTTTTCAAT
GGCGGCAAGGGCTCGGCATCTCTCGAGGAACTGAGATCCGAGGCAGAAGAATTAGCAGATCCTCATTGGAACGCT
GAGTTCTATGATTCTATTGCAAAGCATGTCATCGGGTATGCTCCCTCTAGCCAGCGAGGCAGTGTCAGAGGAACC
GTGAAGCTTCCCAAGGGAGCCGTTCGCCCAATTGCCATTCTCACTGTCGACGGCCAATACTTCCAAGATAATAGC
GCCGTTCCAAGCTCCTATCAGTACTGGACTGATATCAATCAAGATGGAAGCTTCAGCATTGATCGTGTTAAAGAA
GGGAAATACCGACTCACTATTTACGCAGAGGGCATTTTCGGCGACTTTGTACGCGACGGAATCATCATTCATGCA
GGAAGGCAGACTGCACTGCATGATACTTGGACCCAAGAGTCGGCAGGAACTGAGCTCTGGCGAATTGGGATTCCC
GACAAGTCGTCAGGGGAGTTCCGACGTGGAAATGCGAGAGATCCAACCCATCCGCTTCATCCCCCCGAGTATCTT
ATATATTGGGGAGCCTATGACTGGCGCTCTGATTTCCCTGATGGTGTTAATTACACCATTGGAACTAGCGACCCT
GCGACTGATCTCAACTCTGCCCATTGGTCGGTCTTCGGGCCAACGGCAAAGGATTCCCACGTCGAGTATGACACG
ACGTACGACTGGAACATACATTTCAAGCTTGACTCGAAGCAATTGAACAAGCGCAAAACAGCCACATTAACTTTG
CAATTAGCGGCCGCAAAGACCGCAGCCGGTAACACGGATGTGTGGAATCCCCTCGAGTCATACAACAATCTGTCA
CTGGAAAGCTATATCAACAATCAGGCAGATCCTCTGACTCTTGTCGTTGGGTTCAATCAATCAAGCAGCTGTATT
GTGCGGTCTGCTGTCAGCTGCTACCAGGTCGGATCGAAATTGGAGTTCCCGGCGGATTGGTTACATGTCGGTGAC
AATGTGCTGCGATTGCATTTACCTTTCAATGCAACGGATATAGAGACTGCCGTTCTACCTGCCACTGTTTATGTG
CAATACGATGCTATCCGGTTAGAGATACAGTAG
Transcript >Pro_DTO377G3_2|g923.t1
ATGTGGGCTTCCTTATTGACGGCCTTCACGGCAGGGGCTACTGCTGCCACGGCGCTACACATCGCAGAAAACCAG
ACTCACATCACTCTCGCCAATGCTCGCCTCACGGCTGTCCTCCAGAAGAGTGTCGGCCAGATAGTCGATCTAACT
TTGGATGGCCAGGACTTGTTGGGCACTCAGTCGGGATCCACTGGAATAGGGCCCTATCTCGACTGTTACTGTATC
CCTTCGGGCTTCTACACAGCCGGTGCCACATCCCCGAGCACGGAGGTAGTGCAGGGCACAGATTCAACTGGAACC
AAATACGGAGGCATGATTCTGAGTGACACATATACTCCGACGGGACAGCAATTCCAACAGTACTGGTTCCTGCGC
GATGGCGAGACTGGTTTGCATATGTTCAGCCGATTGGCCTACCATAATGAGACCACGCCCTTTCTTCGCAACTTG
CAGGAGTTCCGGACCTTGTTTCGTCCAAATACCGATCTTTGGACGCATCTGACGTCTAGCGAGGTCCAGACCGCA
CCCCTGCCAGGCAAGGACGCGATTTCCAAGGAGATTGTTGTTCAAGATGCAACCTGGACATTTAACAACACGCCA
AGCGACGCGTACTACACCCAATTTTCTGAATATTTTACTAAATATACATTCTCAAATCAATGGAGAAACAATACT
GTTCATGGTCTATATGCTGACGGCAGCACCTCAAATGGGGTAACATATGGAGCTTGGCTAGTCATGAATACCAAG
GATACATATTATGGGGGACCACTCCATTCCGACTTAACAGTGGACGGTATAGTGTACAACTATATCGTATCAAAT
CATCATGGAGAGGGCACGCCAAACATCACAAACGGATTCGATCGAACTTTCGGTCCCCAATTTTACCTTTTCAAT
GGCGGCAAGGGCTCGGCATCTCTCGAGGAACTGAGATCCGAGGCAGAAGAATTAGCAGATCCTCATTGGAACGCT
GAGTTCTATGATTCTATTGCAAAGCATGTCATCGGGTATGCTCCCTCTAGCCAGCGAGGCAGTGTCAGAGGAACC
GTGAAGCTTCCCAAGGGAGCCGTTCGCCCAATTGCCATTCTCACTGTCGACGGCCAATACTTCCAAGATAATAGC
GCCGTTCCAAGCTCCTATCAGTACTGGACTGATATCAATCAAGATGGAAGCTTCAGCATTGATCGTGTTAAAGAA
GGGAAATACCGACTCACTATTTACGCAGAGGGCATTTTCGGCGACTTTGTACGCGACGGAATCATCATTCATGCA
GGAAGGCAGACTGCACTGCATGATACTTGGACCCAAGAGTCGGCAGGAACTGAGCTCTGGCGAATTGGGATTCCC
GACAAGTCGTCAGGGGAGTTCCGACGTGGAAATGCGAGAGATCCAACCCATCCGCTTCATCCCCCCGAGTATCTT
ATATATTGGGGAGCCTATGACTGGCGCTCTGATTTCCCTGATGGTGTTAATTACACCATTGGAACTAGCGACCCT
GCGACTGATCTCAACTCTGCCCATTGGTCGGTCTTCGGGCCAACGGCAAAGGATTCCCACGTCGAGTATGACACG
ACGTACGACTGGAACATACATTTCAAGCTTGACTCGAAGCAATTGAACAAGCGCAAAACAGCCACATTAACTTTG
CAATTAGCGGCCGCAAAGACCGCAGCCGGTAACACGGATGTGTGGAATCCCCTCGAGTCATACAACAATCTGTCA
CTGGAAAGCTATATCAACAATCAGGCAGATCCTCTGACTCTTGTCGTTGGGTTCAATCAATCAAGCAGCTGTATT
GTGCGGTCTGCTGTCAGCTGCTACCAGGTCGGATCGAAATTGGAGTTCCCGGCGGATTGGTTACATGTCGGTGAC
AATGTGCTGCGATTGCATTTACCTTTCAATGCAACGGATATAGAGACTGCCGTTCTACCTGCCACTGTTTATGTG
CAATACGATGCTATCCGGTTAGAGATACAGTAG
Gene >Pro_DTO377G3_2|g923.t1
ATGTGGGCTTCCTTATTGACGGCCTTCACGGCAGGGGCTACTGCTGCCACGGCGCTACACATCGCAGAAAACCAG
ACTCACATCACTCTCGCCAATGCTCGCCTCACGGCTGTCCTCCAGAAGAGTGTCGGCCAGATAGTCGATCTAACT
TTGGATGGCCAGGACTTGTTGGGCACTCAGTCGGGATCCACTGGAATAGGGCCCTATCTCGACTGTTACTGTATC
CCTTCGGGCTTCTACACAGCCGGTGCCACATCCCCGAGCACGGAGGTAGTGCAGGGCACAGATTCAACTGGAACC
AAATACGGAGGCATGATTCTGAGTGACACATATACTCCGACGGGACAGCAATTCCAACAGTACTGGTTCCTGCGC
GATGGCGAGACTGGTTTGCATATGTTCAGCCGATTGGCCTACCATAATGAGACCACGCCCTTTCTTCGCAACTTG
CAGGAGTTCCGGACCTTGTTTCGTCCAAATACCGATCTTTGGACGCATCTGACGTCTAGCGAGGTCCAGACCGCA
CCCCTGCCAGGCAAGGACGCGATTTCCAAGGAGATTGTTGTTCAAGATGCAACCTGGACATTTAACAACACGCCA
AGCGACGCGTACTACACCCAATTTTCTGAATATTTTACTAAATATACATTCTCAAATCGTATGGTCGATCCCCTA
TCTTCTACGGTTACTGATTGACTAAATGATGGTGTTTTCTTAGAATGGAGAAACAATACTGTTCATGGTCTATAT
GCTGACGGCAGCACCTCAAATGGGGTAACATATGGAGCTTGGCTAGTCATGAATACCAAGGTTGGTCATATTACT
CCAATACTCACCAGGTCGAATCCCATCTAACAAATTTATTCTAGGATACATATTATGGGGTAAGCGATATCGAGC
ACGGTGGAATGCAGCGGCTGACATCTATTAGGGACCACTCCATTCCGACTTAACAGTGGACGGTATAGTGTACAA
CTATATCGTATCAAATCATCATGGAGAGGGCACGCCAAACATCACAAACGGATTCGATCGAACTTTCGGTCCCCA
ATTTTACCTTTTCAATGGCGGCAAGGGCTCGGCATCTCTCGAGGAACTGAGATCCGAGGCAGAAGAATTAGCAGA
TCCTCATTGGAACGCTGAGTTCTATGATTCTATTGCAAAGCATGTCATCGGGTATGCTCCCTCTAGCCAGCGAGG
CAGTGTCAGAGGAACCGTGAAGCTTCCCAAGGGAGCCGTTCGCCCAATTGCCATTCTCACTGTCGACGGCCAATA
CTTCCAAGATAATAGCGCCGTTCCAAGCTCCTATCAGTACTGGACTGATATCAATCAAGATGGAAGCTTCAGCAT
TGATCGTGTTAAAGAAGGGAAATACCGACTCACTATTTACGCAGAGGGCATTTTCGGCGACTTTGTACGCGACGG
AATCATCATTCATGCAGGAAGGCAGACTGCACTGCATGATACTTGGACCCAAGAGTCGGCAGGAACTGAGCTCTG
GCGAATTGGGATTCCCGACAAGTCGTCAGGGGAGTTCCGACGTGGAAATGCGAGAGATCCAACCCATCCGCTTCA
TCCCCCCGAGTATCTTATATATTGGGGAGCCTATGACTGGCGCTCTGATTTCCCTGATGGTGTTAATTACACCAT
TGGAACTAGCGACCCTGCGACTGATCTCAACTCTGCCCATTGGTCGGTCTTCGGGCCAACGGCAAAGGATTCCCA
CGTCGAGTATGACACGACGTACGACTGGAACATACATTTCAAGCTTGACTCGAAGCAATTGAACAAGCGCAAAAC
AGCCACATTAACTTTGCAATTAGCGGCCGCAAAGACCGCAGCCGGTAACACGGATGTGTGGAATCCCCTCGAGTC
ATACAACAATCTGTCACTGGAAAGCTATATCAACAATCAGGCAGATCCTCTGACTCTTGTCGTTGGGTTCAATCA
ATCAAGCAGCTGTATTGTGCGGTCTGCTGTCAGCTGCTACCAGGTCGGATCGAAATTGGAGTTCCCGGCGGATTG
GTTACATGTCGGTGACAATGTGCTGCGATTGCATTTACCTTTCAATGCAACGGATATAGAGACTGCCGTTCTACC
TGCCACTGTTTATGTGCAATACGATGCTATCCGGTTAGAGATACAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail